gastric juice protein is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-07-15. Where a claim depends on a specific study, the study is described rather than over-claimed.
Lyophilized material is generally kept cold, commonly at minus twenty degrees Celsius, and shielded from moisture and light. Solutions are less stable than the dry powder, so repeated freeze-thaw cycles are avoided by splitting the material into single-use portions. Published stability data for this particular peptide are limited, which means suggested hold times should be read as provisional. Long-term refrigeration of reconstituted solutions is not well supported by available evidence.
Identity and purity are checked with standard peptide techniques. Reversed-phase high-performance liquid chromatography separates the main peak from closely related impurities and yields a percentage purity. Mass spectrometry confirms that the measured mass matches the theoretical value. Amino acid analysis offers an independent check on overall composition. These analytical methods characterize the material itself and reveal nothing about how it behaves in a living system.
Proposed mechanisms include interaction with the nitric oxide system, modulation of growth factor signaling, and effects on blood vessel formation. None of these has been established as the primary mode of action, and some proposed pathways rest on indirect measurements. Whether the reported effects depend on a specific receptor has not been determined. Stability in gastric acid, unusual for a peptide of this size, is also reported in animal work, but the reason for it is not firmly established.
Published studies on BPC-157 are dominated by animal models. Commonly used endpoints include healing of surgically induced lesions in the stomach, tendon-to-bone attachment after transection, and recovery from experimentally induced vascular or intestinal damage. Many of these reports come from a small number of research groups, and the peptide is often described as acting across a wide range of tissue types. That breadth is itself a point of discussion, since one molecule influencing many unrelated systems is unusual.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white lyophilized powder | Visual inspection of dry material |
| Solubility | Soluble in water | Polar aqueous solvent class |
| Typical storage | Minus 20 degrees Celsius, desiccated, dark | Applies to the lyophilized form |
| Purity assessment | Reversed-phase HPLC | Ultraviolet detection, area percent |
| Identity confirmation | Mass spectrometry | Measured mass compared with theoretical value |
Terminology in the literature is not fully standardised. Papers and product listings use BPC-157, BPC 157, and the longer phrase stable gastric pentadecapeptide BPC 157 interchangeably, and synonyms such as bepecin or PL 14736 appear in older or company-linked publications. Purity claims and reported masses can also differ between sources because peptide preparations may include counterions, residual solvents, or bound water. This variability complicates direct comparison of results across studies and makes the exact identity and grade of a given sample worth verifying. Discussions of the compound should therefore specify the source, salt form, and stated purity where those are known.
BPC-157 is a synthetic peptide composed of fifteen amino acid residues, with the sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. Its name derives from body protection compound, a term used for a protein fraction identified in human gastric juice. Researchers in Zagreb first reported the pentadecapeptide in the early 1990s and described it as a stable fragment of that larger protein. The compound is also catalogued as PL 14736 and, in some commercial contexts, as bepecin. Its molecular formula is C62H98N16O22 and its monoisotopic mass is approximately 1419 daltons.
Within the research literature, the peptide is discussed through several provisional mechanisms, including cytoprotection, modulation of growth factor signaling, and interaction with the nitric oxide system. None of these mechanisms is fully characterized, and no single pathway is universally accepted. Review articles typically note the gap between consistent animal findings and sparse human evidence. The compound is classified as a research chemical rather than an approved pharmaceutical, which shapes how studies are designed, funded, and reported.
BPC-157 is a synthetic pentadecapeptide with the sequence GEPPPGKPADDAGLV, corresponding to a partial fragment of a larger protein detected in human gastric juice. The name derives from the parent protein designation BPC, an abbreviation of body protection compound, with 157 acting as a fraction or batch identifier used by the original investigators. Its molecular weight is approximately 1419 daltons, and the chain contains no unusual residues or disulfide bridges. In the literature it is described as a short, water-soluble fragment rather than a complete natural protein.
Most early work on this peptide originated in the 1990s from a research group in Zagreb, Croatia, relying on animal models and cell cultures. Reported observations included effects on gastrointestinal lesion healing, tendon fibroblast migration, and blood vessel formation under controlled laboratory conditions. These findings come predominantly from rodent studies and in vitro assays rather than from human trials. Controlled human data remain limited, and the degree to which animal results translate to human physiology is an open question rather than a settled fact.
Confirmation of identity and purity relies on standard peptide analysis techniques. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities and serves as the most common purity assay. Mass spectrometry, often coupled to that chromatography step, provides an accurate molecular mass that can be matched against the expected value. Amino acid analysis or sequencing can be added for further confirmation. Because short peptides can be produced by different synthetic routes, laboratories usually report both a chromatographic purity percentage and a mass confirmation rather than a single figure.
BPC-157 is commonly supplied as a lyophilized powder, a freeze-dried solid that is reconstituted before use in laboratory work. As a short peptide, it dissolves readily in water and in aqueous buffer solutions, and stock solutions are typically prepared in water or a mild buffer. The chain contains several proline and acidic residues, which influence how it behaves in solution. Because the solid can take up moisture, weighing and handling are usually performed under low-humidity conditions. Its solubility class is described as freely soluble in water rather than requiring an organic solvent.
Dry powder is generally stored at low temperature, with minus twenty degrees Celsius or colder advised for extended retention. Reconstituted solutions are less stable than the solid form and are normally kept cold and shielded from repeated freeze-thaw cycles. Light exposure is avoided because some peptides degrade under ultraviolet radiation. The exact rate of degradation depends on concentration, pH, and the presence of salts, so a single shelf life does not apply to every preparation. Reported stability figures should be read as indicative of typical handling rather than as universal constants.
=== Fermentation-produced chymosin === Because of the above imperfections of microbial and animal rennets, many producers sought other replacements of rennet. With genetic engineering it became possible to isolate rennet genes from animals and introduce them into certain bacteria, fungi, or yeasts to make them produce recombinant chymosin during fermentation. The genetically modified microorganism is killed after fermentation and chymosin isolated from the fermentation broth, so that the fermentation-produced chymosin (FPC) used by cheese producers does not contain a GMO or any GMO DNA. FPC is identical to chymosin made by an animal, but is produced in a more efficient way. FPC products have been on the market since 1990 and, because the quantity needed per unit of milk can be standardized, are commercially viable alternatives to crude animal or plant rennets, as well as generally preferred to them in industrial production. Originally created by biotechnology company Pfizer, FPC was the first artificially-produced enzyme to be registered and allowed by the US Food and Drug Administration. In 1999, about 60% of US hard cheeses were made with FPC, which thereafter made up to 80% of the global market share for rennet. By 2017, FPC had 90% of the global market share for rennet. By 2021, animal rennet still found use in some traditional or designated European cheeses but FPC covered 80-90% of the market in the US and UK. The most widely used FPC is produced either by the fungus Aspergillus niger and commercialized under the trademark CHY-MAX by the Danish company Chr.
=== The Hagedorn Prize === The Hagedorn Prize, named after Hans Christian Hagedorn, celebrates achievements in the understanding and treatment of diabetes. Hagedorn's work significantly advanced the quality of insulin production and diabetes care, making this award a tribute to his legacy in the field. The Hagedorn Prize is recognised as the most prestigious award in Internal Medicine in Denmark.. Hagedorn died in 1971 at age 83.
HN MAPRGESCLLLLTSEIDLPVKRRA S1 MCHWAGGASNTGDARGDVFGKQAG S2 MGVKFFTLSTREFPSVQRAVPLWTNS S3 MLGYNFSSFPCGTISIAPGENFYRLYFIWVNGLAKVVW S4 MLEVMELVNRRGKICRVPETFFNLSL S5 MYCSEVGFCSEVAPTEIFNAGLWV S6 MLDQDIPMVQPLLKVRLEND
Cell junctions, protein complexes that provide contact between cells and neighbouring cells or the extracellular matrix, are especially abundant in epithelial tissues. They build up the paracellular barrier of epithelia and control the paracellular transport. There are five main types of cell junctions: tight junctions, adherens junctions, desmosomes, hemidesmosomes, and gap junctions.
Supercritical CO2 can be used as a working fluid for geothermal electricity generation in both enhanced geothermal systems and sedimentary geothermal systems (so-called CO2 Plume Geothermal). EGS systems utilize an artificially fractured reservoir in basement rock while CPG systems utilize shallower naturally-permeable sedimentary reservoirs. Possible advantages of using CO2 in a geologic reservoir, compared to water, include higher energy yield resulting from its lower viscosity, better chemical interaction, and permanent CO2 storage as the reservoir must be filled with large masses of CO2. As of 2011, the concept had not been tested in the field.
Sources: en.wikipedia.org
== Production == Bronopol is produced by the bromination of di(hydroxymethyl)nitromethane, which is derived from nitromethane by a nitroaldol reaction. World production increased from the tens of tonnes in the late 1970s to current estimates in excess of 5,000 tonnes. Production today is the business of low cost producers, mainly in China.
GLP requires not only that the methods of safety tests be transparent, but that they be so detailed that a different laboratory using it will get the same result. Considering that Japan, Netherlands, US and others had at same time as GLP begun requiring demonstrations of safety before chemicals gained access markets; the Organisation for Economic Cooperation & Development decided that multinational companies needed globally uniform regulation of chemicals, such that a toxicity test performed in one country could be accepted by another. OECD was thus happy to add the new USA GLP requirement into their new, globally-required test methods, called ‘OECD Test Guidelines’ (see below OECD section).
Geranyl diphosphate synthase (GPPS) first catalyzes the reaction of IPP and DMAPP into geranyl diphosphate. (−)-limonene synthase (LS) catalyzes the cyclization of geranyl diphosphate to (−)-limonene. (−)-Limonene-3-hydroxylase (L3OH), using O2 and then nicotinamide adenine dinucleotide phosphate (NADPH) catalyzes the allylic hydroxylation of (−)-limonene at the 3 position to (−)-trans-isopiperitenol. (−)-trans-Isopiperitenol dehydrogenase (iPD) further oxidizes the hydroxyl group on the 3 position using NAD+ to make (−)-isopiperitenone. (−)-Isopiperitenone reductase (iPR) then reduces the double bond between carbons 1 and 2 using NADPH to form (+)-cis-isopulegone. (+)-cis-Isopulegone isomerase (iPI) then isomerizes the remaining double bond to form (+)-pulegone. (+)-Pulegone reductase (PR) reduces this double bond using NADPH to form (−)-menthone. (−)-Menthone reductase (MR) then reduces the carbonyl group using NADPH to form (−)-menthol.
Having returned to the throne and consolidated his power, the Bourbon king unified the two kingdoms he ruled. With the law of 16 December 1816, the Kingdom of the Two Sicilies was born, with Ferdinand as its first monarch, dubbedFerdinand I of the Two Sicilies.
== Controversy == On February 25, 2020, Consumer Reports published an article stating that GoodRx shared user data—specifically, pseudonymized advertising ID numbers that companies use to track the behavior of web users across websites, the names of the drugs that users browsed, and the pharmacies where users sought to fill prescriptions—with Google, Facebook, and around twenty other Internet-based companies. A few days later, GoodRx released a statement saying that it had made changes to prevent user search data on medical conditions and pharmaceuticals from being shared with Facebook. In March 2020, GoodRx stopped sending data about user prescriptions to Facebook. On February 1, 2023, the Federal Trade Commission fined GoodRx US$1.5 million for violations of the Breach Notification Rule and the Federal Trade Commission Act for allegedly failing to obtain specific, informed, and unambiguous consent from users before disclosing health-related information to Facebook and Google. In November 2024, independent pharmacies filed at least three class action lawsuits against GoodRx and major pharmacy benefit managers. The cases, brought by independent pharmacies in California, Michigan, Pennsylvania, and Rhode Island, allege that GoodRx and the PBMs collaborated to suppress reimbursements for generic prescription drugs. They allege that agreements using GoodRx's software suppressed reimbursements for generic drugs and violated the Sherman Antitrust Act. The suits claim the practices amount to price fixing which harms small pharmacies while benefiting PBMs and their affiliates.
Sources: en.wikipedia.org
Dry powder is commonly held at minus twenty degrees Celsius, desiccated and away from light. Cold storage slows degradation of the lyophilized material.
Mass spectrometry establishes the molecular mass, and reversed-phase chromatography reports purity. A certificate of analysis typically combines both results.
Solutions degrade faster than the dry powder, particularly at room temperature. Portioning into single-use aliquots and freezing reduces losses from repeated thawing.
It is not authorized as a medicine in the United States or the European Union. Regulatory treatment varies by jurisdiction, and in several places it is handled as a research chemical. Therapeutic claims are not supported by large human trials.