research chemical comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2025-04-26. Numbers and descriptions here follow the published literature rather than marketing material.
Cardarine is explicitly prohibited by the World Anti-Doping Agency under the class of PPARδ agonists. Its presence in urine or blood samples can be detected using mass spectrometry-based methods, often liquid chromatography-tandem mass spectrometry. Athletes who test positive may face sanctions, including bans from competition. The compound is also regulated as a prescription-only or unapproved drug in many countries. Enforcement varies by jurisdiction, and some regions treat it as a controlled substance. Online sales may occur despite these restrictions, creating quality and legal risks.
Laboratory detection of cardarine typically involves sample preparation followed by chromatographic separation and mass spectrometric identification. Urine is the most common matrix for anti-doping tests, though blood and hair have also been explored. Methods can target the parent compound or its metabolites, depending on the expected window of detection. Reference standards are required for accurate quantification. Matrix effects and dilution can influence results, so laboratories use internal standards and validation protocols. The exact detection window varies with dose, route, and individual metabolism.
A common misconception is that cardarine has been proven safe for human use. In reality, human clinical data are limited, and long-term animal studies have raised concerns about cancer. Another misconception is that it is a supplement or vitamin-like compound. It is a synthetic research chemical with no approved medical indication. Scientific discussion often focuses on its mechanism and detection rather than therapeutic use. Regulatory and anti-doping literature treats it primarily as a prohibited substance.
Cardarine is not approved for human therapeutic use in any major jurisdiction. It appears on the World Anti-Doping Agency Prohibited List as a PPARδ agonist within the hormone and metabolic modulators category. Sports organizations test for it because it has been detected in athlete samples and seized products. Regulatory actions against marketed research chemical versions have occurred in several countries, though enforcement varies. Availability through unregulated channels complicates oversight.
Analytical laboratories typically identify cardarine and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is a common matrix in anti-doping testing, while blood and tissue may be used in research settings. Detection windows depend on the assay, the sample matrix, and the compound's metabolism. Because cardarine is extensively metabolized, laboratories often target specific metabolites to improve sensitivity and confirmation. Reference standards are required for reliable quantification. Method validation includes checks for selectivity, linearity, and carryover.
A persistent misconception is that cardarine is a fat-burning drug or a safe alternative to anabolic steroids. No approved therapeutic product exists, and human safety data are limited. The tumor findings in rodents remain a central concern in scientific reviews. Products sold online may contain inaccurate labels, impurities, or different compounds entirely, which complicates any assessment of effects. Independent testing of such products has reported frequent mislabeling. For these reasons, discussions in the literature emphasize risks and unknowns rather than benefits.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Prohibited in sport | Listed by WADA as a PPARδ agonist. |
| Typical detection matrix | Urine | Most common sample for anti-doping analysis. |
| Common analytical method | LC-MS/MS | Liquid chromatography-tandem mass spectrometry. |
| Common synonyms | GW501516, GSK-516, endurobol | Names found in research and fitness contexts. |
| Typical detection window | Variable | Depends on dose, route, and individual metabolism. |
At the molecular level, GW501516 binds and activates PPARδ, a nuclear receptor that regulates transcription. Activation shifts expression of genes involved in fatty acid oxidation, energy expenditure, and lipid transport in skeletal muscle and liver. Animal studies report increased endurance and altered lipid profiles after exposure. Human data are limited to small trials and do not establish long-term safety or efficacy. PPARδ also has roles in cell proliferation, so the relationship between activation and cancer risk remains an open question.
Published literature on cardarine includes in vitro assays, rodent experiments, and a small number of human studies. Reports describe effects on exercise capacity and lipid metabolism in animals, while human evidence is sparse. Many online descriptions present the compound as a proven endurance aid, a claim not supported by regulatory approval or large clinical trials. Analytical studies focus on identifying the parent compound and its metabolites in biological samples. Important uncertainties include species differences, dose-response relationships, and the relevance of rodent tumor findings to humans.
Human trials of GW501516 were small and short in duration. They examined lipid levels, glucose handling, and other metabolic markers, but the programs were halted after the animal cancer findings. No approved therapeutic product exists, and published human data are insufficient for establishing long-term safety. Reports of use for athletic performance come mainly from non-clinical settings and cannot be verified through controlled trials. Independent testing of products sold as cardarine has found inconsistent purity and labeling.
Laboratory studies indicate that GW501516 activates PPARδ, a nuclear receptor involved in fatty acid oxidation and energy metabolism. In rodent experiments, treated animals often showed increased endurance and reduced fat mass. These effects were observed under controlled conditions and do not establish safe or effective use in humans. The exact dose-response relationship in humans remains poorly characterized. Species differences in metabolism can affect how results translate across animals and people.
Safety concerns emerged from long-term animal studies. In rodents given the compound for extended periods, researchers found an increased incidence of certain cancers, including liver and bladder tumors. These findings contributed to the discontinuation of clinical development. Whether similar risks apply to short-term or low-level exposure in humans is not established, and controlled human safety data are limited. The relevance of high-dose rodent carcinogenicity findings to human use remains a subject of debate.
Hydrogen halides and their solutions: hydrofluoric acid (HF), hydrochloric acid (HCl), hydrobromic acid (HBr), hydroiodic acid (HI) Halogen oxoacids: hypochlorous acid (HClO), chlorous acid (HClO2), chloric acid (HClO3), perchloric acid (HClO4), and corresponding analogs for bromine and iodine Hypofluorous acid (HFO), the only known oxoacid for fluorine. Sulfuric acid (H2SO4) Fluorosulfuric acid (HSO3F) Nitric acid (HNO3) Phosphoric acid (H3PO4) Fluoroantimonic acid (HSbF6) Fluoroboric acid (HBF4) Hexafluorophosphoric acid (HPF6) Chromic acid (H2CrO4) Boric acid (H3BO3) A sulfonic acid has the general formula RS(=O)2–OH, where R is an organic radical. Methanesulfonic acid (or mesylic acid, CH3SO3H) Ethanesulfonic acid (or esylic acid, CH3CH2SO3H) Benzenesulfonic acid (or besylic acid, C6H5SO3H) p-Toluenesulfonic acid (or tosylic acid, CH3C6H4SO3H) Trifluoromethanesulfonic acid (or triflic acid, CF3SO3H) Polystyrene sulfonic acid (sulfonated polystyrene, [CH2CH(C6H4)SO3H]n)
The enzyme 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14), commonly known as KDPG aldolase, catalyzes the chemical reaction 2-dehydro-3-deoxy-D-gluconate 6-phosphate ⇌ {\displaystyle \rightleftharpoons } pyruvate + D-glyceraldehyde 3-phosphate This enzyme belongs to the family of lyases, specifically the aldehyde-lyases, which cleave carbon-carbon bonds. It is used in the Entner–Doudoroff pathway in prokaryotes, feeding into glycolysis. 2-dehydro-3-deoxy-phosphogluconate aldolase is one of the two enzymes distinguishing this pathway from the more commonly known Embden–Meyerhof–Parnas pathway. This enzyme also participates in following 3 metabolic pathways: pentose phosphate pathway, pentose and glucuronate interconversions, and arginine and proline metabolism. In addition to the cleavage of 2-dehydro-3-deoxy-D-gluconate 6-phosphate, it is also found to naturally catalyze Schiff base formation between a lysine ε-amino acid group and carbonyl compounds, decarboxylation of oxaloacetate, and exchange of solvent protons with the methyl hydrogen atoms of pyruvate.
The 3D structure of human serum albumin has been determined by X-ray crystallography to a resolution of 2.5 ångströms (250 pm). Albumin is a 65–70kDa protein. Albumin comprises three homologous domains that assemble to form a heart-shaped protein. Each domain is a product of two subdomains that possess common structural motifs. The principal regions of ligand binding to human serum albumin are located in hydrophobic cavities in subdomains IIA and IIIA, which exhibit similar chemistry. Structurally, the serum albumins are similar, each domain containing five or six internal disulfide bonds. Worldwide, certain traditional Chinese medicines contain wild bear bile, banned under CITES legislation. Dip sticks, similar to common pregnancy tests, have been developed to detect the presence of bear albumin in traditional medicine products, indicating that bear bile had been used in their creation. Albumin is pronounced ; formed from Latin: albumen "egg white", itself derived from the Latin albus: white.
Sources: en.wikipedia.org
The Bailey peptide synthesis is a name reaction in organic chemistry developed 1949 by J. L. Bailey. It is a method for the synthesis of a peptide from α-amino acid-N-carboxylic acid anhydrides (NCAs) and amino acids or peptide esters. The reaction is characterized by short reaction times and a high yield of the target peptide. The reaction can be carried out at low temperatures in organic solvents. The residues R1 and R2 can be organic groups or hydrogen atoms, R3 is the used amino acid or peptide ester: The reaction mechanism is not known in detail. Supposedly, the reaction begins with a nucleophilic attack of the amino group on the carbonyl carbon of the anhydride group of the N-carboxylic acid anhydride (1). After an intramolecular proton migration, a 1,4-proton shift and the cleavage of carbon dioxide follows, resulting in the peptide bond in the final product (2):
Adenylyl-sulfate reductase (glutathione) (EC 1.8.4.9) is an enzyme that catalyzes the chemical reaction AMP + sulfite + glutathione disulfide ⇌ {\displaystyle \rightleftharpoons } adenylyl sulfate + 2 glutathione The 3 substrates of this enzyme are adenosine monophosphate, sulfite, and glutathione disulfide, whereas its two products are adenylyl sulfate and glutathione. This enzyme belongs to the family of oxidoreductases, specifically those acting on a sulfur group of donors with a disulfide as acceptor. The systematic name of this enzyme class is AMP,sulfite:glutathione-disulfide oxidoreductase (adenosine-5'-phosphosulfate-forming). Other names in common use include 5'-adenylylsulfate reductase (also used for, internal_xref(ec_num(1,8,99,2))), AMP,sulfite:oxidized-glutathione oxidoreductase, (adenosine-5'-phosphosulfate-forming), and plant-type 5'-adenylylsulfate reductase. In plants, APS is reduced by the plastidic enzyme APS reductase (APR; EC 1.8.4.9) in the presence of physiological concentrations of reduced glutathione (GSH), which acts as an electron donor.
Acetylcysteine or N-acetylcysteine (NAC) is a mucolytic that is used to treat paracetamol (acetaminophen) overdose and to loosen thick mucus in individuals with chronic bronchopulmonary disorders, such as pneumonia and bronchitis. It has been used to treat lactobezoar in infants. It can be taken intravenously, orally (swallowed by mouth), or by inhalation by use of a nebulizer. It is also sometimes used as a dietary supplement. Common side effects include nausea and vomiting when taken orally. The skin may occasionally become red and itchy with any route of administration. A non-immune type of anaphylaxis may also occur. It appears to be safe in pregnancy. For paracetamol overdose, it works by increasing the level of glutathione, an antioxidant that can neutralize the toxic breakdown products of paracetamol. When inhaled, it acts as a mucolytic by decreasing the thickness of mucus. Acetylcysteine was initially patented in 1960 and came into medical use in 1968. It is on the World Health Organization's List of Essential Medicines. It is available as a generic medication.
White was married to his wife Edna for more than 40 years. He died unexpectedly on February 14, 1980, in Santa Barbara, California, where he had gone that day from his home in Palo Alto to deliver a lecture at the University of California. Several awards in the field of biochemistry have been named for White, including at Oakland University in Michigan, Wayne State University, George Washington University School of Medicine and the Gladstone Institutes. 1935 – Traveling Fellowship, American Physiological Society, for the XVth International Congress of Physiology (Leningrad and Moscow) 1938 – Eli Lilly Prize in Biochemistry 1960 – Distinguished Alumni Award, University of Denver 1967 – Sesquicentennial Alumni Award, University of Michigan 1969 – Borden Award, Association of American Medical Colleges 1959 – Doctor of Humane Letters, Yeshiva University 1975 – Doctor of Science, University of Denver
Sources: en.wikipedia.org
ABS-201 is an AI-designed monoclonal antibody against the prolactin receptor (PRLR) currently in Phase 1/2a clinical trial for the treatment of androgenic alopecia (pattern hair loss) and endometriosis. It is taken by subcutaneous injection. ABS-201 is a possible first-in-class drug with a novel mechanism of action in the potential treatment of hair loss. ABS-201 is under development by Absci. It is believed that ABS-201 works by activating dormant hair follicles and causing them to move from the telogen phase to the anagen phase. In human ex vivo scalp model studies, ABS-201 stimulated hair regrowth, prolonged anagen phase, blocked catagen phase, inhibited telogen effluvium, and blocked hair from losing color. ABS-201 has been found to produce robust hair regrowth as compared with minoxidil in mice and balding macaques. The clinical trial for ABS-201 is being overseen by prominent hair loss researcher Rodney Sinclair, one of the principal investigators in minoxidil clinical trials. The chemical structure of the drug does not yet appear to have been disclosed.
Network Science, Part 5: Solvent-Accessible Surfaces AREAIMOL is a command line tool in the CCP4 Program Suite for calculating ASA. NACCESS solvent accessible area calculations. FreeSASA Open source command line tool, C library and Python module for calculating ASA. Surface Racer Oleg Tsodikov's Surface Racer program. Solvent accessible and molecular surface area and average curvature calculation. Free for academic use. ASA.py — a Python-based implementation of the Shrake-Rupley algorithm. Michel Sanner's Molecular Surface – the fastest program to calculate the excluded surface. pov4grasp render molecular surfaces. Molecular Surface Package — Michael Connolly's program. Volume Voxelator — A web-based tool to generate excluded surfaces. ASV freeware Analytical calculation of the volume and surface of the union of n spheres (Monte-Carlo calculation also provided). Vorlume Computing Surface Area and Volume of a Family of 3D Balls. GetArea Calculate solvent accessible surface area of proteins online. ProMS ProMS - Protein Molecular Surface Calculator
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
There have been many efforts to engineer and improve new AAV variants for both clinical and research purposes. Such modifications include new tropisms to target specific tissues, and modified surface residues to evade detection by the immune system. Beyond opting for particular strains of recombinant AAV (rAAV) to target particular cells, researchers have also explored AAV pseudotyping, the practice of creating hybrids of certain AAV strains to approach an even more refined target. The hybrid is created by taking a capsid from one strain and the genome from another strain. For example:
Many different inventions and ideas which may or may not have been practical about auto safety have been put forward but never made it to a production car. Such items include the driver seat in the middle (to give the person a better view) (the exception being the McLaren F1 super car) and control stick steering. Automotive safety may have become an issue almost from the beginning of mechanised road vehicle development. The second steam-powered "Fardier" (artillery tractor), created by Nicolas-Joseph Cugnot in 1771, is reported by some to have crashed into a wall during its demonstration run. However, according to Georges Ageon, the earliest mention of this occurrence dates from 1801 and it does not feature in contemporary accounts. One of the earliest recorded car-related fatalities was Mary Ward, on August 31, 1869, in Parsonstown, Ireland. In 1922, the Duesenburg Model A became the first car to have four-wheel hydraulic brakes.
Sources: en.wikipedia.org
Yes, WADA prohibits cardarine as a PPARδ agonist. It appears on the prohibited list and can be detected in urine or blood. Athletes using it risk sanctions.
Detection usually uses liquid chromatography-tandem mass spectrometry after sample cleanup. Laboratories look for the parent compound or metabolites. The method requires validated reference standards and controls.
Legality varies by country. In many places it is an unapproved drug and cannot be legally sold for human consumption. Purchasing from online vendors carries legal and quality risks.
No. Cardarine has not received approval for human therapeutic use in major jurisdictions. It remains an investigational compound.