If you have been reading about Freeze-thaw and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2025-09-17. Where a claim depends on a specific study, the study is described rather than over-claimed.
The sequence places several glycine and proline residues near the middle, which may influence how the chain folds in solution. The peptide is linear rather than cyclic, and it carries no disulfide bridges. Commercial material is commonly supplied as the acetate salt, although the free base and other counterion forms also appear. Because the term BPC-157 refers to a specific sequence, samples with slight sequence variants are chemically different substances. Published work generally treats the fifteen-residue sequence as the defining structure.
Physical descriptions in supplier documents and papers usually list the compound as a white to off-white powder. It dissolves readily in water and in common aqueous buffers, and solutions are often prepared fresh before an experiment. Molecular mass near 1419 daltons helps verify identity during mass spectrometry. The powder is somewhat hygroscopic, so moisture exposure can alter the measured mass of a sample. Purity is typically reported as a percentage from chromatographic analysis.
Handling practice centers on limiting moisture, heat, and mechanical stress. Powder is typically allowed to reach room temperature before opening so that condensation does not form on the contents, and solutions are prepared with sterile or low-particulate water. Peptides can adsorb to certain plastics and membrane filters, so container and filter material is sometimes specified to reduce losses at low concentrations. Working aliquots are usually frozen separately rather than sampled repeatedly from one stock. Recording lot number, preparation date, and storage conditions supports later comparison between experiments.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography, which separates the target peptide from truncated sequences and other synthesis by-products. Mass spectrometry, typically electrospray ionization coupled to liquid chromatography, confirms the expected mass and helps detect modifications. Amino acid analysis can verify composition when residue-level confirmation is needed. Because common impurities differ from the target by only one or two residues, chromatographic resolution often matters more than a single headline purity percentage. Impurity profiles are most informative when compared against a validated reference standard.
Lyophilized material is generally reported as stable for extended periods when kept cold, dry, and protected from light. In solution, the main degradation routes for a peptide of this type are hydrolysis of peptide bonds and aggregation. The sequence contains no cysteine, so disulfide-driven oxidation is not a primary concern, though methionine and tryptophan are also absent. Stability depends on pH, buffer composition, and concentration, with acidic conditions often reported as more favorable than neutral or alkaline ones. Repeated freeze-thaw cycles can promote aggregation, and how fast degradation proceeds at room temperature in specific formulations remains an open question.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C62H98N16O22 | Approximate, for sequence GEPPPGKPADDAGLV |
| Molecular mass | ~1419 Da | Neutral form |
| Appearance | White to off-white powder | Lyophilized solid |
| Solubility | Soluble in water | Also soluble in aqueous buffers |
| Typical storage | -20 C | Dry powder, protected from moisture |
Material of this kind is sold for laboratory research, and labels typically state that it is not intended for human or veterinary use. In many countries it is not an approved medicine, and sports antidoping rules place it among prohibited non-approved substances. Buyers commonly review a certificate of analysis, an independent test report, and the declared storage conditions. Batch-to-batch variation in purity and in counterion content is possible, and how much that variation affects experimental outcomes remains an open question.
Lyophilized peptide is normally kept at minus twenty degrees Celsius or colder, away from light and moisture. Powder held under those conditions is widely treated as stable for long periods, although published stability studies for this exact sequence are sparse and often come from suppliers rather than independent laboratories. Once dissolved, solutions are generally handled cold and used within a short window, because peptide bonds can hydrolyze over time. Repeated freeze-thaw cycles are usually avoided to limit losses, and exact shelf-life figures depend on the buffer and the concentration involved.
Several mechanisms have been proposed to explain the activity observed in animal models. The most frequently cited involve signaling through vascular endothelial growth factor receptor 2 and modulation of the nitric oxide system. Researchers have also described interactions with protective pathways in the gut lining. These proposed mechanisms appear in the literature as hypotheses supported by preclinical observations, not as confirmed pathways in humans. The precise way the peptide produces its reported effects, and whether those effects carry across species, remain areas of active and unresolved investigation.
BPC-157 is a synthetic pentadecapeptide, meaning it consists of fifteen amino acids joined in a single chain. Its sequence is Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val, a fragment corresponding to part of a larger protein found in human gastric juice. The peptide was first described in the 1990s by researchers in Zagreb who were studying gastric protective factors. It is not a naturally circulating hormone; it is a laboratory-made fragment derived from a stomach protein. The name is an abbreviation of body protection compound, with the number referring to the fragment's position in the source protein.
Most published work on BPC-157 comes from animal experiments rather than controlled human trials. Rodent models have examined its effects on gastrointestinal lesions, tendon and ligament injury, and blood vessel formation. These studies are often small and originate from a limited number of research groups, which affects how broadly the findings can be generalized. No large randomized human trial has been reported in the peer-reviewed literature. Discussion of the compound therefore rests largely on preclinical data, and questions about its effects in people remain open rather than settled.
== History == Vinblastine was first isolated by Robert Noble and Charles Thomas Beer at the University of Western Ontario from the Madagascar periwinkle plant. The structure of Vinblastine and Vincristine are very similar. There are some differences in their pharmacological effects only and there is no cross-resistance. Vinblastine's utility as a chemotherapeutic agent was first suggested by its effect on the body when an extract of the plant was injected in rabbits to study the plant's supposed anti-diabetic effect. (A tea made from the plant was a folk-remedy for diabetes.) The rabbits died from a bacterial infection, due to a decreased number of white blood cells, so it was hypothesized that vinblastine might be effective against cancers of the white blood cells such as lymphoma. It was approved by FDA in 1965.
21 March – Leo Varadkar launched the Government's national action plan to tackle racism in response to persistent racial discrimination in Ireland. The plan drew on a report published in April 2021 by the Anti Racism Committee, established in 2020 by the Department of Children, Equality, Disability, Integration and Youth. 31 March RTÉ announced that Radio 1 would permanently stop broadcasting on the longwave band on 14 April. The Supreme Court ruled that legislation governing the election of senators to the Seanad university panels was unconstitutional due to the failure for over 40 years to legislate for the Seventh Amendment of the Constitution of Ireland.
Disinfectants: Destroy or inactivate microorganisms (bacteria, fungi, viruses,) but may not act as sporicides (as those are the most difficult form to destroy). According to efficacy data, the EPA will classify a disinfectant as limited, general/ broad spectrum, or as a hospital disinfectant. Sanitizers: Reduce the number of microorganisms, but may not kill or eliminate all of them. Sterilizers (Sporicides): Eliminate all bacteria, fungi, spores, and viruses.
Moscow was angry with Western appeasement of Adolf Hitler after the signing of the Munich Agreement in 1938 which gave Nazi Germany partial control of Czechoslovakia after conference in which the Soviet Union was not invited. In 1939, after conducting negotiations with both the British and French group and Germany regarding potential military and political agreements, the Soviet Union and Germany signed a Commercial Agreement providing for the trade of certain German military and civilian equipment in exchange for Soviet raw materials and the Molotov–Ribbentrop Pact, commonly named after the foreign secretaries of the two countries (Molotov–Ribbentrop), which included a secret agreement to split Poland and Eastern Europe between the two states.
Aram Barlezizyan, Professor Emeritus Aram Barlézizian at the Yerevan State Linguistic University after V. Brusov. Armenia Guy Bennett, American writer and translator, Professor at Otis College of Art and Design Bruno Bernard, Belgian professor and writer on export and business ethics Roméo Bosetti, Italian-born silent film director and actor. Louis Dewis, born Isidore Louis Dewachter in Belgium. Merchant and later a post-impressionist painter, he was honoured for his civic endeavors in the early 1900s Edith Dumont, Lieutenant Governor of Ontario Ahmed H. Fahal (2017), Professor of Surgery at the University of Khartoum, who especially in Mycetoma. Allan L. Goldstein, American biochemist and co-discoverer of the Thymosins Mary Riter Hamilton, Canada's first female battlefield artist Michael Hawcroft, Associate Professor of French at the University of Oxford, a specialist in Racine and Molière. Notable former students include L. Inglesfield and Geoffrey Roberts. Ralph M. Hester, Professor of French, Stanford University, co-author of Découverte et Création, the most widely used textbook for teaching French in the United States in the 1970s and 1980s. A. Majeed Khan, Bangladeshi educator for education, science and culture. Jihane Kasshanna, Lebanese founder of the SFELK French school in Northern Nigeria, the only one of its kind in the region James A. Kilker, Southern Illinois professor Emeritus, a specialist in French civilization, Kilker was known for his courses on French influence in the Mississippi Valley, which included tours of historic sites at St.
Sources: en.wikipedia.org
=== Other disease areas === The majority of ADCs under development or in clinical trials are for oncological and hematological indications. This is primarily driven by the inventory of monoclonal antibodies, which target various types of cancer. However, some developers are looking to expand the application to other important disease areas.
=== Antidepressants === Medications that are indicated for both anxiety disorders and depression. Selective serotonin reuptake inhibitors (SSRIs) and serotonin–norepinephrine reuptake inhibitors (SNRIs) are new generations of antidepressants. They have a much lower adverse effect profile than older antidepressants like monoamine oxidase inhibitors (MAOIs) and tricyclic antidepressants (TCAs). Therefore, SSRIs and SNRIs are now the first-line agent in treating long term anxiety disorders, given their applications and significance in all six types of disorders.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
===== Teleost fish ===== Like non-placental vertebrates, teleost fish also possess 5-HT cells in other sections of the brain, including the basal forebrain. Danio rerio (zebra fish) are a species of teleost fish often used for studying serotonin within the brain. Despite much being unknown about serotonergic systems in vertebrates, the importance in moderating stress and social interaction is known. It is hypothesized that AVT and CRF cooperate with serotonin in the hypothalamic-pituitary-interrenal axis. These neuropeptides influence the plasticity of the teleost, affecting its ability to change and respond to its environment. Subordinate fish in social settings show a drastic increase in 5-HT concentrations. High levels of 5-HT long term influence the inhibition of aggression in subordinate fish.
where α represents alpha particle, β− represents beta particle, λ represents decay constant and t1/2 represents half-life. Monazite geochronology studies the ratio of parent isotopes to daughter isotopes (isotopic ratio), and calculates how much time has passed since daughter isotopes start accumulating.
Sources: en.wikipedia.org
White blood cells The G-CSF-receptor is present on precursor cells in the bone marrow, and, in response to stimulation by G-CSF, initiates proliferation and differentiation into mature granulocytes. G-CSF stimulates the survival, proliferation, differentiation, and function of neutrophil precursors and mature neutrophils. G-CSF regulates them using Janus kinase (JAK)/signal transducer and activator of transcription (STAT) and Ras/mitogen-activated protein kinase (MAPK) and phosphatidylinositol 3-kinase (PI3K)/protein kinase B (Akt) signal transduction pathway. Hematopoietic System G-CSF is also a potent inducer of hematopoietic stem cell (HSC) mobilization from the bone marrow into the bloodstream, although it has been shown that it does not directly affect the hematopoietic progenitors that are mobilized. Neurons G-CSF can also act on neuronal cells as a neurotrophic factor. Indeed, its receptor is expressed by neurons in the brain and spinal cord. The action of G-CSF in the central nervous system is to induce neurogenesis, to increase the neuroplasticity and to counteract apoptosis. These properties are currently under investigations for the development of treatments of neurological diseases such as cerebral ischemia.
==== Behavioral consequences ==== The hyperactivity and difficulties in emotional regulation found in pediatric patients (children) are not reported in adults. OSA in adults is nevertheless associated with personality changes and automatic behavior. The biggest impact of OSA is the excessive daytime sleepiness (EDS), reported in approximately 30% of OSA patients. EDS can be caused by the disturbance of sleep quality, the insufficient sleep duration or the sleep fragmentation and it is responsible for further complications as it may lead to depressive symptoms, impairments of social life and decreased effectiveness at work. Studies have shown that those consequences of EDS can be improved following a CPAP treatment.
Cyanocobalamin is a form of vitamin B12 used to treat and prevent vitamin B12 deficiency except in the presence of cyanide toxicity. The deficiency may occur in pernicious anemia, following surgical removal of the stomach, with fish tapeworm, or due to bowel cancer. It is given by mouth, by injection into a muscle, or as a nasal spray. Cyanocobalamin is generally well tolerated. Minor side effects may include diarrhea, nausea, upset stomach, and itchiness. Serious side effects may include anaphylaxis, and low blood potassium resulting in heart failure. Use is not recommended in those who are allergic to cobalt or have Leber's disease. No overdosage or toxicity has been recorded by the FDA. It is less preferred than hydroxocobalamin for treating vitamin B12 deficiency because it has a slightly lower bioavailability. Some studies have shown it to possess an antihypotensive effect. Vitamin B12 is an essential nutrient meaning that it cannot be made by the body but is required for life. Cyanocobalamin was first manufactured in the 1940s. It is available as a generic medication and over the counter. In 2023, it was the 104th most commonly prescribed medication in the United States, with more than 6 million prescriptions.
== Prevention == A study was done to compare the sperm outcomes of individuals with or without infection of the human papilloma virus (HPV), which currently affects 79 million Americans. The study concluded that individuals who had not been infected with HPV had higher rates of sperm motility, functionality, and concentration of sperm. This study suggests that individuals who do not contract HPV or who are vaccinated against HPV have better fertility outcomes than those who are not vaccinated or who have contracted HPV. Vaccination against HPV with Gardasil9 can be administered by hospitals, clinics or most pharmacies in 3 doses ideally at age 11–12 in both girl and boys, but can be taken up to age 45 per Center of Disease Control (CDC) guidelines.
=== Competition binding === Competition binding is used to determine the presence of selectivity for a particular ligand for receptor sub-types, which allows the determination of the density and proportion of each sub-type in the tissue. Competition curves are obtained by plotting specific binding, which is the percentage of the total binding, against the log concentration of the competing ligand. A steep competition curve is usually indicative of binding to a single population of receptors, whereas a shallow curve, or a curve with clear inflection points, is indicative of multiple populations of binding sites.
Sources: en.wikipedia.org
The letters BPC stand for body protection compound. The number 157 refers to a specific fragment designation from early work on gastric proteins. The full name is a label for a synthetic fifteen-amino-acid peptide rather than a naturally isolated drug.
No. The gastric protein is larger, while BPC-157 is a short fragment sequence. The peptide is produced synthetically for research use. The relationship is one of sequence origin, not chemical identity.
It is most often supplied as a lyophilized powder, frequently as the acetate salt. The powder is reconstituted with water or a buffer before use. Free-base and other salt forms also exist but are less common in catalogs.
Reversed-phase liquid chromatography with ultraviolet detection gives a purity estimate, while mass spectrometry confirms molecular mass and flags modifications. Amino acid analysis can add compositional confirmation. Results are most meaningful when a validated reference standard is run alongside the sample.