This is a working overview of gastric juice protein, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-06-29 and is reviewed periodically as new material appears.
Lyophilized material is generally kept cold, commonly at minus twenty degrees Celsius, and shielded from moisture and light. Solutions are less stable than the dry powder, so repeated freeze-thaw cycles are avoided by splitting the material into single-use portions. Published stability data for this particular peptide are limited, which means suggested hold times should be read as provisional. Long-term refrigeration of reconstituted solutions is not well supported by available evidence.
Identity and purity are checked with standard peptide techniques. Reversed-phase high-performance liquid chromatography separates the main peak from closely related impurities and yields a percentage purity. Mass spectrometry confirms that the measured mass matches the theoretical value. Amino acid analysis offers an independent check on overall composition. These analytical methods characterize the material itself and reveal nothing about how it behaves in a living system.
Proposed mechanisms include interaction with the nitric oxide system, modulation of growth factor signaling, and effects on blood vessel formation. None of these has been established as the primary mode of action, and some proposed pathways rest on indirect measurements. Whether the reported effects depend on a specific receptor has not been determined. Stability in gastric acid, unusual for a peptide of this size, is also reported in animal work, but the reason for it is not firmly established.
Published studies on BPC-157 are dominated by animal models. Commonly used endpoints include healing of surgically induced lesions in the stomach, tendon-to-bone attachment after transection, and recovery from experimentally induced vascular or intestinal damage. Many of these reports come from a small number of research groups, and the peptide is often described as acting across a wide range of tissue types. That breadth is itself a point of discussion, since one molecule influencing many unrelated systems is unusual.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white lyophilized powder | Visual inspection of dry material |
| Solubility | Soluble in water | Polar aqueous solvent class |
| Typical storage | Minus 20 degrees Celsius, desiccated, dark | Applies to the lyophilized form |
| Purity assessment | Reversed-phase HPLC | Ultraviolet detection, area percent |
| Identity confirmation | Mass spectrometry | Measured mass compared with theoretical value |
Terminology in the literature is not fully standardised. Papers and product listings use BPC-157, BPC 157, and the longer phrase stable gastric pentadecapeptide BPC 157 interchangeably, and synonyms such as bepecin or PL 14736 appear in older or company-linked publications. Purity claims and reported masses can also differ between sources because peptide preparations may include counterions, residual solvents, or bound water. This variability complicates direct comparison of results across studies and makes the exact identity and grade of a given sample worth verifying. Discussions of the compound should therefore specify the source, salt form, and stated purity where those are known.
BPC-157 is a synthetic peptide composed of fifteen amino acid residues, with the sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. Its name derives from body protection compound, a term used for a protein fraction identified in human gastric juice. Researchers in Zagreb first reported the pentadecapeptide in the early 1990s and described it as a stable fragment of that larger protein. The compound is also catalogued as PL 14736 and, in some commercial contexts, as bepecin. Its molecular formula is C62H98N16O22 and its monoisotopic mass is approximately 1419 daltons.
Most early work on this peptide originated in the 1990s from a research group in Zagreb, Croatia, relying on animal models and cell cultures. Reported observations included effects on gastrointestinal lesion healing, tendon fibroblast migration, and blood vessel formation under controlled laboratory conditions. These findings come predominantly from rodent studies and in vitro assays rather than from human trials. Controlled human data remain limited, and the degree to which animal results translate to human physiology is an open question rather than a settled fact.
Within the research literature, the peptide is discussed through several provisional mechanisms, including cytoprotection, modulation of growth factor signaling, and interaction with the nitric oxide system. None of these mechanisms is fully characterized, and no single pathway is universally accepted. Review articles typically note the gap between consistent animal findings and sparse human evidence. The compound is classified as a research chemical rather than an approved pharmaceutical, which shapes how studies are designed, funded, and reported.
BPC-157 is a synthetic pentadecapeptide with the sequence GEPPPGKPADDAGLV, corresponding to a partial fragment of a larger protein detected in human gastric juice. The name derives from the parent protein designation BPC, an abbreviation of body protection compound, with 157 acting as a fraction or batch identifier used by the original investigators. Its molecular weight is approximately 1419 daltons, and the chain contains no unusual residues or disulfide bridges. In the literature it is described as a short, water-soluble fragment rather than a complete natural protein.
Confirmation of identity and purity relies on standard peptide analysis techniques. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities and serves as the most common purity assay. Mass spectrometry, often coupled to that chromatography step, provides an accurate molecular mass that can be matched against the expected value. Amino acid analysis or sequencing can be added for further confirmation. Because short peptides can be produced by different synthetic routes, laboratories usually report both a chromatographic purity percentage and a mass confirmation rather than a single figure.
BPC-157 is commonly supplied as a lyophilized powder, a freeze-dried solid that is reconstituted before use in laboratory work. As a short peptide, it dissolves readily in water and in aqueous buffer solutions, and stock solutions are typically prepared in water or a mild buffer. The chain contains several proline and acidic residues, which influence how it behaves in solution. Because the solid can take up moisture, weighing and handling are usually performed under low-humidity conditions. Its solubility class is described as freely soluble in water rather than requiring an organic solvent.
== Traditional Chinese medicine == It is one of the 50 fundamental herbs used in traditional Chinese medicine, where it has the name huángqín (Chinese: 黄芩). As a Chinese traditional medicine, huang qin usually refers to the dried root of S. baicalensis Georgi, S. viscidula Bge., S. amoena C.H. Wright, and S. ikoninkovii Ju.
Prior to the Apollo program (1968–1975), early space food development was conducted at the United States Air Force School of Aerospace Medicine and the Natick Army Labs. The variety of food options continued to expand for the Apollo missions, as the new availability of hot water made rehydrating freeze-dried foods simpler and produced a more appetizing result. This was an important aspect during the Apollo missions, since astronauts would be spending longer amounts of time in space. Appetizing foods would increase the crew's chances of maintaining proper nutrition, and the "spoon-bowl" allowed more normal eating practices. Food could be kept in special plastic zip-closure containers, and moisture allowed the food to stick to a spoon. However, the lack of taste was an issue at that time, as the food was prepared with very few spices to avoid overstimulating the gastrointestinal system. Thus, the astronauts were always looking for something that had a little more taste; Apollo 17 moonwalker Harrison Schmitt's favorite food was the bacon squares, while Buzz Aldrin enjoyed the shrimp and Paul J. Weitz went for the ice cream. In the later Apollo missions, foods were improved to make use of retort pouches and cans. This allowed the food to be thermally stabilized, enabling it to be stored for longer durations of time.
== See also == Artificial intelligence in Brazilian industry Artificial intelligence industry in India Artificial intelligence industry in Italy Artificial intelligence industry in Taiwan Artificial intelligence industry in Canada Parliamentary Under-Secretary of State for AI and Digital Government Science and technology in the United Kingdom
== Manufacturing == PRP is prepared by taking blood from the person, and then putting it through centrifugation designed to separate PRP from platelet-poor plasma and red blood cells. This is usually done in the clinic, using commercially available kits and equipment. The resulting substance varies from person to person and from facility to facility.
=== Pharmacokinetics === The pharmacokinetics of BRD-6929 in animals have been described. The drug penetrates into the brain in rodents. In addition, unlike vorinostat, it showed a sustained duration in the brain in rodents (t1/2 = 0.44 hours and 6.44 hours, respectively). BRD-6929 also penetrates into the brain in baboons, albeit with relatively low brain levels compared to plasma levels.
Sources: en.wikipedia.org
Nurses affiliated with the New Zealand Nurses Organisation in Auckland and Whangārei commence industrial action to protest staff shortages. A member of the New Zealand Defence Force pleads guilty before a court-martial to attempted espionage on behalf of a foreign country, in the first espionage conviction in New Zealand. He is sentenced to two years' imprisonment on 20 August. 19 August: The Interislander and Bluebridge cancel several ferry sailings due to strong swells in the Cook Strait. Foreign Minister Winston Peters recalls Trevor Mallard as New Zealand ambassador to Ireland, designating Angela Hassan-Sharp as his successor. Employees of media company Stuff vote to take strike action to protest their employer's plan to split their collective bargaining agreement. 20 August: Secondary school teachers affiliated with the Post Primary Teachers' Association went on strike for a day after rejecting the Government's one percent pay rise offer. The New Zealand Cabinet agrees to draft legislation banning greyhound racing in New Zealand. 21 August: Defence Minister Judith Collins and Foreign Minister Winston Peters announce that the Government will purchase two new Airbus A321XLR jets and five MH-60R Seahawks for the New Zealand Defence Force. Carter Holt Harvey proposes closing its Eves Valley Sawmill in the Tasman District, potentially affecting 142 jobs. Airliner Jetstar admits to 20 charges of breaching the Fair Trading Act 1986 by misleading customers about compensation.
Therefore, in practice, a chiral method development laboratory settings, acts like a high-throughput screening protocol, of conducting a systematic screening of various CSP's by advanced column switching devices, trying automatically and systematically various mobile-phase combinations, effectively employing a trial-and-error strategy. Because of the highly complex retention mechanism of a chiral stationary-phase due to chiral recognition, whose principles have not been deciphered, it is often difficult, if not impossible to predict in advance the steps that can be successfully applied to the enantiomers at hand as part of method development. That's why the standard approach in the method development is high throughput screening, to evaluate or examine a series of stationary phases, using various mobile-phase combinations, to increase the chance of finding a suitable separation condition.
A radium industry developed, using radium in creams, beverages, chocolates, toothpastes, and soaps. It took a relatively long time for radium and its decay product radon to be recognized as the cause of the observed effects. Radithor, a radioactive agent consisting of triple-distilled water in which the radium isotopes 226Ra and 228Ra were dissolved so that it had an activity of at least one microcurie, was marketed in the United States. It was not until 1932, when the prominent American athlete Eben Byers, who by his own account had taken about 1,400 vials of Radithor as medicine on the recommendation of his physician, fell seriously ill with cancer, lost many of his teeth, and died shortly thereafter in great agony, that strong doubts were raised about the healing powers of Radithor and radium water.
== The leading research groups, producers and applications == One of the leading groups in academy for creating ion-trap MMS is Prof. Graham Cooks with his associate Professor Zheng Ouyang at Purdue University. They have built a series of mini mass spectrometer based on quadrupole ion trap called Mini 10, Mini 11, Mini 12. The group used Mini 10 mass spectrometer weighing 10 kg to analyze proteins, peptides and alkaloids in complex plant materials with electrospray ionization ESI and paperspray ionization. The group used low radio frequency of resonant ion ejection to increase mass range up to 17,000 Da proteins. For interfacing ESI source with MMS, a 10 cm stainless steel capillary was fabricated to transfer the ions directly into the vacuum manifold. The resulting high pressure of 20 mTorr, which is several orders of magnitude higher than that used in lab-scale mass spectrometers is compensated by using the pressure-tolerant rectilinear ion trap. One of the key component of this MMS is the commercial turbo-bump and the MS can be operated at 10−3 torr. To overcome the problem of continuous sample introduction because of the small size of the pump, the group developed a technique called discontinuous atmospheric pressure introduction (DAPI). This technique performs direct chemical analysis without sample pretreatment and enables the coupling of miniature mass spectrometers to atmospheric pressure ionization sources, including ESI, atmospheric pressure chemical ionization (APCI), and various ambient ionization sources.
== Pharmacokinetics == The major source of retinoids in the human diet is plant pigments such as carotenes and retinyl esters derived from animal sources. Retinyl esters are transported through the chylomicron pathway to the liver or fat tissue while retinol or carotenes are transported from the enterocytes to the liver and are processed into retinyl esters by LRAT for storage. Most synthetic retinoids are absorbed when taken orally, while topical retinoids cannot diffuse through the skin barrier unless it is compromised. All classes of retinoid bind to many proteins. Natural retinoids such as retinol and retinyl esters bind to carrier proteins such as RBP4, chylomicrons and VLDL while synthetic retinoids likely bind to these and other proteins. First generation retinoids are rapidly metabolized by Cytochrome p450 enzymes, typically of the Cyp26 family.
Sources: en.wikipedia.org
The current epidemic of obesity and eating disorders undermines these theories. The set point theories of hunger and eating are inconsistent with basic evolutionary pressures related to hunger and eating as they are currently understood. Major predictions of the set point theories of hunger and eating have not been confirmed. They fail to recognize other psychological and social influences on hunger and eating.
Their enhanced catalytic activity over other ligands in palladium-catalyzed coupling reactions have been attributed to their electron-richness, steric bulk, and some special structural features. In particular, cyclohexyl, t-butyl, and adamantyl groups on the phosphorus are used for this purpose as bulky, electron-donating substituents. The lower ring of the biphenyl system, ortho to the phosphino group, is also a key structural feature. Numerous crystallographic studies have indicated that it behaves as a hemilabile ligand and is believed to play a role in stabilizing the highly reactive, formally 12-electron L–Pd0 intermediate during the catalytic cycle. 2,6-Substitution on the lower ring minimizes catalyst decomposition via Pd-mediated C-H activation of these positions. Extensive experimentation by the Buchwald group has shown that further minor changes to the structure of these ligands can dramatically alter their catalytic activity in cross coupling reactions with different substrates. This has led to the evolution of multiple ligands that are tailored for specific transformations. By providing a means of generating the postulated catalytically active L–Pd0 species under mild conditions (room temperature or lower in many cases), the development of several generations of base-activated, cyclopalladated precatalysts have further broadened the applicability of the ligands and simplified their use.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
As well as express terms, and terms incorporated by notice, terms may be implied by courts. Terms are implied on the facts of a case when there is a gap if this is reasonable and equitable, necessary for business efficacy, so obvious it goes without saying, capable of clear expression, and consistent with the express terms. Terms are also implied by law where 'the enjoyment of the rights conferred by the contract would or could be rendered nugatory, worthless or perhaps be seriously undermined' without the term. First there are a range of terms that benefit employers. The employee has a duty to obey orders that are lawful (e.g. not breaching the Fair Work Act 2009, or the Privacy Act 1988) and reasonable. For instance, in Anderson v Sullivan it was held that the state employer could require police officers to take a drug test even though it picked up use during private time. However in Australian Tramways Employees' Association v Brisbane Tramways Co Ltd Higgins J held that an employee had a 'common law right' to 'wear what he chooses, to act as he chooses, in matters not affecting work' including wearing a discreet union badge. The employer may also be owed fiduciary duties that enable them to appropriate the benefits of work beyond the contract.
Sources: en.wikipedia.org
Dry powder is commonly held at minus twenty degrees Celsius, desiccated and away from light. Cold storage slows degradation of the lyophilized material.
Mass spectrometry establishes the molecular mass, and reversed-phase chromatography reports purity. A certificate of analysis typically combines both results.
Solutions degrade faster than the dry powder, particularly at room temperature. Portioning into single-use aliquots and freezing reduces losses from repeated thawing.
It is not authorized as a medicine in the United States or the European Union. Regulatory treatment varies by jurisdiction, and in several places it is handled as a research chemical. Therapeutic claims are not supported by large human trials.