Everything below concerns Fifteen residues. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2025-08-13. Where a claim depends on a specific study, the study is described rather than over-claimed.
Most published findings come from rodent models, where the peptide has been examined in wound-healing, gastrointestinal-lesion, tendon, and vascular-injury preparations. A smaller number of early human studies have been reported, chiefly in inflammatory bowel conditions, but the public record is short and has not led to marketing approval in the United States or the European Union. Reviewers therefore classify the compound as investigational, and whether animal results carry over to people remains an open question rather than a settled one.
Outside laboratory supply channels, the peptide is sold as a research chemical, a category that carries no requirement to demonstrate purity, identity, or freedom from contamination. Because it is not an approved medicine, products labeled BPC-157 sit in a regulatory gap in many countries, and actual content may differ from the label. Sports organizations list it among prohibited substances, so its presence in an athlete's sample can produce a doping finding regardless of how the material was obtained.
Some properties, such as the peptide's sequence and molecular mass, are firmly established. Other claims, particularly about mechanism and clinical benefit, remain open questions. Proposed mechanisms include effects on nitric oxide signaling and on cell migration, but these are hypotheses supported by limited evidence. Reviewers often note that the field lacks large controlled human trials. Positive animal findings are best treated as signals for further study rather than as settled conclusions.
Most published studies examine BPC-157 in animal models rather than in humans. Common subjects include rats and mice, and researchers often use models of tissue injury, surgery, or induced inflammation. Reported endpoints include healing rates, blood vessel formation, and markers of tissue repair. These designs provide controlled comparisons, but findings in animals do not automatically transfer to people. Human clinical data remain limited and are frequently described as preliminary.
| Property | Value | Notes |
|---|---|---|
| Origin | Fragment of a protein found in human gastric juice | Sequence corresponds to a fifteen-residue portion of the parent protein |
| Sequence | GEPPPGKPADDAGLV | Single linear chain, fifteen amino acids |
| Reported molecular weight | About 1419 daltons | Value quoted consistently in supplier and review literature |
| Regulatory status | Not an approved human medicine in the US or EU | Handled and sold as a research chemical |
| Sports status | Listed as prohibited | Falls under non-approved-substance categories in anti-doping codes |
Evidence in humans is limited. Small clinical studies have examined the peptide in contexts such as ulcerative colitis and wound healing, but participant numbers are small and independent replication is scarce. It is not approved as a medicine by major regulatory agencies and is distributed mainly as a research material or compounded preparation. Long-term human safety data are not established, and questions about absorption through non-injected routes remain open rather than resolved. Claims about its effects are best read against these gaps.
BPC-157 is a synthetic peptide of fifteen amino acids, written in single-letter code as GEPPPGKPADDAGLV. The sequence corresponds to a partial fragment of a protein isolated from human gastric juice, described in early reports as body protection compound. The number 157 refers to a fragment designation in that work rather than to molecular mass. Initial descriptions appeared in the early 1990s, when the fragment was reported to protect gastrointestinal tissue in animal models. Commercial material is produced by solid-phase peptide synthesis rather than extracted from biological sources.
Most published findings come from rodent experiments using induced injury or surgical models. Human reports remain scarce and are largely observational, which limits how much can be stated with confidence. Questions about absorption, distribution, metabolism, and clearance in people are still open. Dose translation between species is likewise unresolved. Researchers tend to read the animal literature as a starting point rather than a settled account.
BPC-157 is a synthetic peptide composed of fifteen amino acids. Its sequence corresponds to part of a protein found in human gastric juice, which is the origin of the "body protection compound" label. In laboratory work the material is treated as a defined research chemical rather than a finished product. Published research has centered on animal models, and the peptide is not an approved medicine in most countries.
The peptide was first described in the early 1990s by a group studying gastric secretions and tissue repair. Its fifteen-residue chain is usually written as GEPPPGKPADDAGLV in single-letter code. The free peptide has the formula C62H98N16O22 and a theoretical mass near 1419.5 daltons. These identifiers are established chemical facts that can be checked against standard peptide databases. There is no ambiguity about the primary structure.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometers, a wavelength that captures the peptide backbone. The main peak area is reported as a percentage of total peak area, which serves as a conventional purity figure. Mass spectrometry provides an independent check on molecular mass and helps confirm the expected sequence. Additional tests may include amino acid analysis and water content determination. Results are only comparable when the same column, gradient, and detection settings are used.
Peptides are susceptible to hydrolysis, oxidation, and aggregation, and BPC-157 is no exception. The lyophilized powder form is generally more stable than a solution because residual moisture is low and molecular mobility is reduced. Once dissolved, the peptide is exposed to water, oxygen, and trace metal ions that accelerate degradation. Light exposure and repeated freeze-thaw cycles are also commonly cited as sources of loss. These general principles guide most handling recommendations found in supplier documentation.
Standard practice for the solid form is storage at minus twenty degrees Celsius or colder, kept dry and away from light. Containers are usually sealed with a desiccant to limit moisture uptake. Reconstituted solutions are typically held at two to eight degrees Celsius and used within a short window, because potency can decline over days to weeks depending on the buffer and concentration. Freezing an already dissolved sample may help, though repeated thawing is discouraged. Specific shelf-life claims vary between suppliers and are rarely supported by published stability studies.
NETA is marketed in high-dose 5 mg oral tablets in the United States under the brand names Aygestin and Norlutate for the treatment of gynecological disorders. In addition, it is available under a large number of brand names at much lower dosages (0.1 to 1 mg) in combination with estrogens such as ethinylestradiol and estradiol as a combined oral contraceptive and for use in menopausal hormone therapy for the treatment of menopausal symptoms. NETA has been studied for use as a potential male hormonal contraceptive in combination with testosterone in men. Ethinylestradiol/norethisterone acetate Norethisterone enanthate
The species A. maxima and A. platensis were once classified in the genus Spirulina. The common name, spirulina, refers to the dried biomass of A. platensis, which belongs to photosynthetic bacteria that cover the groups Cyanobacteria and Prochlorophyta. Scientifically, a distinction exists between spirulina and the genus Arthrospira, for which the two species were originally proposed. Species of Arthrospira have been isolated from alkaline brackish and saline waters in tropical and subtropical regions. Among the various species included in the genus Arthrospira, A. platensis is the most widely distributed and is mainly found in Africa, but also in Asia. The term "spirulina" (without italicizing and usually without capitalization) remains in use for historical reasons. In 2019 it was found that the cultivated species differ too much from the type species of Arthospira to be in the genus, necessitating another batch of renaming to Limnospira to reflect biological reality.
GLD-2 (which stands for Germ Line Development 2) is an enzyme which in humans is encoded by the gene TENT2. More specifically, it is a cytoplasmic poly(A) polymerase (cytoPAPs) which adds successive AMP monomers to the 3’ end of specific RNAs, forming a poly(A) tail, which is a process known as polyadenylation. For RNA specificity, GLD-2 associates with an RNA-binding protein, typically a GLD-3, to form a heterodimer that acts as a cytoplasmic PAP. This protein has an enzymatic function and belongs to a family (DNA polymerase type-B-like family) which includes several similar enzymes such as GLD-1, GLD-3 and GLD-4. This family of cytoplasmic PAPs has been described in several different species including Homo sapiens, Caenorhabditis elegans, Xenopus, Mus musculus and Drosophila. Moreover, as it is a cytoplasmtaic PAP it differs from nuclear PAPs in some aspects. While nuclear PAPs contain a catalytic domain and an RNA-binding domain, GLD-2 family members have only a catalytic domain.
The most widely used method to determine absolute molar mass is size-exclusion chromatography (SEC) coupled with multi-angle laser light scattering (MALS). SEC can separate macromolecules based on their size by passing an analyte containing molecules of different sizes through a column containing porous substrate. Larger components of the analyte spend less time traveling through these pores and therefore elute faster, while smaller components can access more of these pores and are therefore retained longer. However, molar masses determined through SEC require calibration curves constructed from standards, and calculating absolute molar masses require absolute detection systems. The two primary detection systems used to determine absolute molar mass are light scattering photometers and viscometers. Static light scattering (SLS) experiments measure the difference between the light scattered by a dilute solution and the light scattered through pure solvent. Given a dilute enough solution and at an angle of θ = 0° between the incident light and the scattering direction, this difference, known as the excess Rayleigh ratio ΔR(θ), can be approximately related to the weight-average molar mass Mw through the equation:
Ketone bodies can be used as fuels, yielding 22 ATP and 2 GTP molecules per acetoacetate molecule when oxidized in the mitochondria. Ketone bodies are transported from the liver to other tissues, where acetoacetate and beta-hydroxybutyrate can be reconverted to acetyl-CoA to produce reducing equivalents (NADH and FADH2), via the citric acid cycle. Ketone bodies cannot be used as fuel by the liver, because the liver lacks the enzyme β-ketoacyl-CoA transferase, also called thiolase. Acetoacetate in low concentrations is taken up by the liver and undergoes detoxification through the methylglyoxal pathway which ends with lactate. Acetoacetate in high concentrations is absorbed by cells other than those in the liver and enters a different pathway via 1,2-propanediol. Though the pathway follows a different series of steps requiring ATP, 1,2-propanediol can be turned into pyruvate.
Sources: en.wikipedia.org
Both agonist and antagonist bond the same active site. Adding agonist dose can reverse the effect of reversible competitive antagonism. Irreversible competitive antagonism occurs when the antagonist binds to the same spot on the receptor as the agonist but dissociates from the receptors very slowly or not. As a result, when the agonist is delivered, there is no change in the antagonist occupancy. Since a receptor can only hold one molecule at a time, competitive antagonists can reduce the agonist occupancy (percentage of receptors to which the agonist is bound). Raising the agonist concentration can bring back the agonist occupancy and the subsequent tissue response due to their competition. Thus, the opposition is surmountable. The amount to which the competitive antagonist causes the agonist log concentration–effect curve to shift to the right while maintaining its maximum slope is a measure of the dosage ratio. The antagonist concentration causes the dosage ratio to rise linearly.
12(S)-HpETE and 12(S)-HETE induce itching responses when injected into the skin of mice; this has led to the suggestion that these metabolites contribute to the itching (i.e. clinical pruritus) which accompanies such conditions as atopic dermatitis, contact dermatitis, urticaria, chronic renal failure, and cholestasis. Since it mediates 12(S)-HETE-induced itching in the mouse model, BLT2 rather than GPR31 may mediate human itch in these reactions.
The use of RdRp plays a major role in RNA interference in eukaryotes, a process used to silence gene expression via small interfering RNAs (siRNAs) binding to mRNA rendering them inactive. Eukaryotic RdRp becomes active in the presence of dsRNA, and is less widely distributed than other RNAi components as it lost in some animals, though still found in C. elegans, P. tetraurelia, and plants. This presence of dsRNA triggers the activation of RdRp and RNAi processes by priming the initiation of RNA transcription through the introduction of siRNAs. In C. elegans, siRNAs are integrated into the RNA-induced silencing complex, RISC, which works alongside mRNAs targeted for interference to recruit more RdRps to synthesize more secondary siRNAs and repress gene expression. Spiegelman's Monster NS5B inhibitor RNA+Replicase at the U.S. National Library of Medicine Medical Subject Headings (MeSH) EC 2.7.7.48
APHL supports the role of the public health laboratory in disease detection and surveillance, and works to expand and enhance relationships among member laboratories, by coordinating with the CDC, other federal and state agencies, associations and academia involved in relevant public health activities, including laboratory testing, policy and training. As of December 2021 the director of this group was Kelly Wroblewski. APHL's infectious disease programs focuses on continuous monitoring on spread of the following infectious diseases including: Arboviruses, including West Nile, Dengue, Chikungunya and Zika viruses Coronavirus (COVID-19) Ebola HIV Influenza Rabies Sexually transmitted diseases including Chlamydia, Gonorrhea, Herpes Simplex Virus, HPV, Syphilis and Trichomoniasis Tuberculosis Vaccine preventable diseases, including measles, mumps and rubella (MMR vaccines) and diphtheria, tetanus and pertussis (DTP) Viral Hepatitis
Commercial availability varies by country. Approved systems in various countries, described further below, include MiniMed 670G or 780G, Tandem's Control-IQ, Omnipod 5, CamAPS FX, and Diabeloop DBLG1. In September 2016, the FDA approved the Medtronic MiniMed 670G, which was the first approved hybrid closed loop system. The device automatically adjusts a patient's basal insulin delivery. It is made up of a continuous glucose monitor, an insulin pump, and a glucose meter for calibration. It automatically functions to modify the level of insulin delivery based on the detection of blood glucose levels by continuous monitor. It does this by sending the blood glucose data through an algorithm that analyzes and makes the subsequent adjustments. The system has two modes. Manual mode lets the user choose the rate at which basal insulin is delivered. Auto mode regulates basal insulin levels from the CGM readings every five minutes.
Sources: en.wikipedia.org
Can resolve fine-scale variations in chemical elements. Can be used to identify the presence and distribution of different phases in materials. Requires less sample material and therefore can provide information on microscopic objects. Handling of small quantities is not always simple. Higher accuracy of weighing is necessary (e.g. use of accurate balance). Sample surface preparation can have a major impact on measurement results.
BMPs for clinical use are produced using recombinant DNA technology (recombinant human BMPs; rhBMPs). Recombinant BMP-2 and BMP-7 are currently approved for human use. rhBMPs are used in oral surgeries. BMP-7 has also recently found use in the treatment of chronic kidney disease (CKD). BMP-7 has been shown in murine animal models to reverse the loss of glomeruli due to sclerosis. A 2022 study by researchers from the Mayo Clinic, Maastricht University, and Ethris GmBH, a biotech company that focuses on RNA therapeutics, found that chemically modified mRNA encoding BMP-2 promoted dosage-dependent healing of femoral osteotomies in male rats. The mRNA molecules were complexed within nonviral lipid particles, loaded onto sponges, and surgically implanted into the bone defects. They remained localized around the site of application. Compared to receiving rhBMP-2 directly, bony tissues regenerated after mRNA treatment displayed superior strength and less formation of massive callus.
A protein is represented by a three-dimensional open chain, and determining whether that chain contains a mathematical knot requires the chain to be closed by an auxiliary procedure. The result can depend on how the closure is performed, particularly for shallow knots or chains with complicated geometry. AlphaKnot therefore provides both probabilistic and deterministic closure procedures and reports the resulting knot type together with additional information about the location of the knotted region. AlphaKnot was initially developed to analyze the rapidly growing number of protein structures predicted by AlphaFold. The expansion of structure-prediction databases made it possible to search for protein knots on a scale that was not practical using experimentally determined structures alone.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The tertiary structure and topology of TMEM125 was predicted and visualized through Phyre2. TMEM125 has 1 predicted phosphorylation site (CK2 Phos), 5 predicted N-myristoylation sites (N-myr), 2 predicted palmitoylation sites (Pal), and 1 predicted amidation site (Amid). It also contains the domain of unknown function 66 (DUF66). TMEM125 is predicted to be subcellularly localized in the plasma membrane. It is secondarily predicted to be localized in the endoplasmic reticulum. There were no scientifically-verified protein interactions identified for TMEM125. String Protein Interaction predicted 10 functional protein partners for TMEM125, but all were determined through textmining. TMEM125 is conserved in species as distantly related to humans as cartilaginous fish, that’s most recent common ancestor to humans existed 465 million years ago. TMEM125 is highly conserved in primates, mammals, birds, reptiles, bony fish, and cartilaginous fish, but is not observed in invertebrates. TMEM125 does not have any paralogs.
Sources: en.wikipedia.org
It is not approved for human use in the United States or the European Union. Clinical material has been studied in a small number of early trials, mainly for inflammatory bowel conditions, and the compound remains investigational. Regulators treat marketed products as unapproved rather than as authorized drugs.
The peptide was named after a protein fraction found in human gastric juice, and the shorter form was called body protection compound. That phrase was shortened to the abbreviation BPC. The number 157 refers to a laboratory designation used in the original isolation work.
Its sequence corresponds to a segment of a protein present in gastric secretions, but the material supplied for research is made synthetically. No commercial product is purified from human or animal tissue. The synthetic route is used because it gives a defined chain length and a reproducible sequence.
Human data are limited. Most evidence comes from animal experiments and from small or uncontrolled reports. The absence of large trials means clinical effects and safety are not firmly established.