dose range comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-06-14. Where a claim depends on a specific study, the study is described rather than over-claimed.
Published storage guidance follows general peptide practice rather than product-specific studies. The dry powder is typically kept at minus 20 degrees Celsius, away from light and moisture. Once reconstituted, solutions are generally refrigerated and used over days to weeks, because the aqueous environment slowly promotes hydrolysis and oxidation. Long-term data on degradation rates or breakdown products are sparse. Stated shelf lives from different producers vary widely, reflecting the absence of a shared reference standard.
BPC-157 is a synthetic peptide built from fifteen amino acid residues. Its sequence comes from a larger protein fragment that researchers isolated from human gastric juice and described as a body protection compound. The fragment contains glycine, glutamic acid, five prolines, lysine, alanine, two aspartic acids, leucine, and valine. The number 157 in the name refers to the position of the stretch within the parent protein. Material used in laboratories is manufactured rather than extracted from stomach fluid.
The molecule carries 15 residues, a molar mass near 1419.5 g/mol, and the formula C62H98N16O22. Its structure features a proline-rich central region, a pair of adjacent aspartic acid residues, and no cysteine. The absence of cysteine means no disulfide bonds can form, which simplifies refolding and reconstitution. Suppliers usually ship the material as a freeze-dried powder that appears white to off-white. It dissolves readily in water and in saline solutions.
Purity is ordinarily reported as a percentage from reverse-phase high-performance liquid chromatography, where the area of the main peak is compared with the total peak area. Identity is confirmed by mass spectrometry, since the measured mass can be checked against the value calculated from the sequence. Some certificates also include amino acid analysis or sequence confirmation by tandem mass spectrometry. A single purity number does not describe the profile of related impurities, so the underlying chromatogram and spectrum usually carry more information than the headline figure.
Material of this kind is sold for laboratory research, and labels typically state that it is not intended for human or veterinary use. In many countries it is not an approved medicine, and sports antidoping rules place it among prohibited non-approved substances. Buyers commonly review a certificate of analysis, an independent test report, and the declared storage conditions. Batch-to-batch variation in purity and in counterion content is possible, and how much that variation affects experimental outcomes remains an open question.
| Property | Value | Notes |
|---|---|---|
| Molar mass | Approximately 1419.5 g/mol | Calculated from the reported 15-residue sequence |
| Molecular formula | C62H98N16O22 | Based on the same sequence |
| Appearance | White to off-white powder | Typical of a lyophilized preparation |
| Solubility class | Freely soluble in water | Also dissolves in saline solutions |
| Typical storage temperature | Minus 20 degrees Celsius, dry | Refrigeration advised after reconstitution |
Most published studies examine BPC-157 in animal models rather than in humans. Common subjects include rats and mice, and researchers often use models of tissue injury, surgery, or induced inflammation. Reported endpoints include healing rates, blood vessel formation, and markers of tissue repair. These designs provide controlled comparisons, but findings in animals do not automatically transfer to people. Human clinical data remain limited and are frequently described as preliminary.
Doses in the literature are usually expressed in micrograms or nanograms per kilogram of body weight. Investigators have administered the peptide by several routes, including injection and oral delivery, depending on the question asked. Route and dose vary widely across studies, which complicates direct comparison of results. Many papers report effects at low doses, but the absence of a standardized protocol limits generalization. Reporting practice differs between research groups.
The peptide was first described in the early 1990s by a group studying gastric secretions and tissue repair. Its fifteen-residue chain is usually written as GEPPPGKPADDAGLV in single-letter code. The free peptide has the formula C62H98N16O22 and a theoretical mass near 1419.5 daltons. These identifiers are established chemical facts that can be checked against standard peptide databases. There is no ambiguity about the primary structure.
Most published findings come from rodent experiments using induced injury or surgical models. Human reports remain scarce and are largely observational, which limits how much can be stated with confidence. Questions about absorption, distribution, metabolism, and clearance in people are still open. Dose translation between species is likewise unresolved. Researchers tend to read the animal literature as a starting point rather than a settled account.
BPC-157 is a synthetic peptide composed of fifteen amino acids. Its sequence corresponds to part of a protein found in human gastric juice, which is the origin of the "body protection compound" label. In laboratory work the material is treated as a defined research chemical rather than a finished product. Published research has centered on animal models, and the peptide is not an approved medicine in most countries.
The citric acid cycle is regulated mainly by the availability of key substrates, particularly the ratio of NAD+ to NADH and the concentrations of calcium, inorganic phosphate, ATP, ADP, and AMP. Citrate – the ion that gives its name to the cycle – is a feedback inhibitor of citrate synthase and also inhibits PFK, providing a direct link between the regulation of the citric acid cycle and glycolysis.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Immunofluorescence imaging in the human U2OS cell line (bone Osteosarcoma epithelial cells) shows localization in the cytosol. Immunohistochemistry imaging of human prostate tissue also suggests cytosolic localization. A bipartite nuclear localization signal is predicted at position 128 – 143, which is highly conserved in mammalian orthologs (see Fig.2.), indicating possible localization in the nucleus. The predicted promoter sequence for this gene spans from base pair 37196852 to 37198126 (1,275 bp) and has multiple predicted binding sites for transcription factors such as GATA binding factors, SMAD3, TP63 and NRF1. MIPOL1 is ubiquitously expressed at low levels in humans, with highest expression in the prostate. The RNA secondary structure is stabilized by multiple stem loops that have been predicted (using bioinformatics tools), and conserved across closely related species. Multiple binding targets are found for microRNAs such as MIR3163 and MIR190a, that could silence these regions on the mRNA and inhibit translation.
The American Society for Biochemistry and Molecular Biology publishes three research journals and a monthly magazine covering society news and activity updates. ASBMB journals are peer-reviewed and cover research in the fields of microbiology, molecular genetics, RNA-related research, proteomics, genomics, transcription, peptides, cell signaling, lipidomics, and systems biology. All articles are published online as "Papers in Press" upon acceptance. As of January 2021, all three ASBMB journals are fully open access.
Sources: en.wikipedia.org
Milk immunity is the protection provided to immune system of an infant via the biologically active components in milk, typically provided by the infant's mother. All mammalian milk contains water, sugar, fat, vitamins, and protein, with the variation within and between species and individuals differing mainly in the amount of these components. Other than the variation in quantity of these components, not a lot is known about bio-active or immune-modulating factors in many mammalian species. However, in comparison to other mammalian milk, human milk has the most oligosaccharide diversity. Ruminant mothers do not transfer immunity to their infants during pregnancy, which makes milk the first introduction to maternal immunity calves receive. Bovine milk contains both immunoglobulins A and G, but in contrast to human milk where IgA is the most abundant, IgG is more abundant. Secretory component, IgM, both anti-inflammatory and inflammatory cytokines, and other proteins with antimicrobial functions are also present in bovine milk.
Chondrocytes (, from Greek χόνδρος (chondros) 'cartilage' and κύτος (kytos) 'cell') are the only cells found in healthy cartilage. They produce and maintain the cartilaginous matrix, which consists mainly of collagen and proteoglycans. Although the word chondroblast is commonly used to describe an immature chondrocyte, the term is imprecise, since the progenitor of chondrocytes (which are mesenchymal stem cells) can differentiate into various cell types, including osteoblasts. From least- to terminally-differentiated, the chondrocytic lineage is:
Hox genes play a massive role in some amphibians and reptiles in their ability to regenerate lost limbs, especially HoxA and HoxD genes. If the processes involved in forming new tissue can be reverse-engineered into humans, it may be possible to heal injuries of the spinal cord or brain, repair damaged organs and reduce scarring and fibrosis after surgery. Despite the large conservation of the Hox genes through evolution, mammals and humans specifically cannot regenerate any of their limbs. This raises a question as to why humans which also possess an analog to these genes cannot regrow and regenerate limbs. Beside the lack of specific growth factor, studies have shown that something as small as base pair differences between amphibian and human Hox analogs play a crucial role in human inability to reproduce limbs. Undifferentiated stem cells and the ability to have polarity in tissues is vital to this process.
Sources: en.wikipedia.org
Drug titration is the process of adjusting the dose of a medication for the maximum benefit without adverse effects. When a drug has a narrow therapeutic index, titration is especially important, because the range between the dose at which a drug is effective and the dose at which side effects occur is small. Some examples of the types of drugs commonly requiring titration include insulin, anticonvulsants, blood thinners, anti-depressants, and sedatives. Titrating off of a medication instead of stopping abruptly is recommended in some situations. Glucocorticoids should be tapered after extended use to avoid adrenal insufficiency. Drug titration is also used in phase I of clinical trials. The experimental drug is given in increasing dosages until side effects become intolerable. A clinical trial in which a suitable dose is found is called a dose-ranging study. Therapeutic drug monitoring Pituri – chewed as a stimulant (or, after extended use, a depressant) by Aboriginal Australians
Outer Membrane Vesicle (OMV) vaccines contain the outer membrane of a bacterium without any of its internal components or genetic material. Thus, ideally, they stimulate an immune response effective against the original bacteria without the risk of an infection. Genetic vaccines deliver nucleic acid that codes for an antigen into host cells, which then produce that antigen, stimulating an immune response. This category of vaccine includes DNA vaccines, RNA vaccines, and viral vector vaccines, which differ in the chemical form of nucleic acid and how it is delivered into host cells. A variety of vaccine types are under development; see Experimental Vaccine Types. Most vaccines are given by hypodermic or intramuscular injection as they are not absorbed reliably through the gut. Live attenuated polio and some typhoid and cholera vaccines are given orally in order to produce immunity based in the bowel.
SPATT was introduced in 2004 as a method of monitoring aquatic toxins. This tool is able to adsorb toxins generated by microalgae or cyanobacteria, known as cyanotoxins. The adsorption is passive, and the biotoxins adhere to porous, resin filled sachets, or SPATT bags where they are then physically removed and examined. SPATT is a useful tool in tracking algal blooms as it is reliable, sensitive, and inexpensive. It has the ability to quickly alert the existence of aquatic toxins which prevents it from bioaccumulating in marine life. One of the downsides is that it does not give very good results for water-soluble toxins as compared to hydrophobic compounds. This tool is mainly used to determine intercellular concentrations of toxins but the cyanobacteria can also be lysed to determine the total toxin amount in a sample. Other drawbacks, such as a lack in calibration and the ability to only monitor dissolved toxins, make it difficult for this tool to be implemented in a more widespread manner. However, SPATT devices are able to detect many lipophilic and hydrophilic toxins that are linked to harmful algal bloom.
When measured by fatalities per person transported, however, buses are the safest form of transportation. The number of air travel fatalities per person are surpassed only by bicycles and motorcycles. This statistic is used by the insurance industry when calculating insurance rates for air travel. For every billion kilometers traveled, trains have a fatality rate that is 12 times higher than that of air travel, and the fatality rate for automobiles is 62 times greater than for air travel. By contrast, for every billion journeys taken, buses are the safest form of transportation; using this measure, air travel is three times more dangerous than car transportation, and almost 30 times more dangerous than travelling by bus. A 2007 study by Popular Mechanics magazine found that passengers sitting at the back of an aeroplane are 40% more likely to survive a crash than those sitting at the front. The article quotes Boeing, the FAA, and a website on aircraft safety, all of which claim that there is no "safest" seat. The study examined 20 crashes, not taking into account the developments in safety after those accidents. However, a flight data recorder is usually mounted in the aircraft's empennage (tail section) where it is more likely to survive a severe crash. Between 1983 and 2000, the survival rate for people in U.S. plane crashes was greater than 95 percent.
Sources: en.wikipedia.org
It does not occur in the form that is supplied commercially. Its sequence matches a fragment of a larger gastric protein, and the research material is produced synthetically in a laboratory. The fragment described in the early literature is generally the same synthetic pentadecapeptide.
It marks the position of the sequence inside the original protein. The label traces back to early work fractionating gastric juice and describing a body protection compound. The figure does not refer to molecular weight or to the count of amino acids.
No. The sequence has no cysteine residues, so disulfide bridges cannot form. That feature makes it easier to handle than many small proteins that depend on multiple cysteines for structure.
The standard approach is reverse-phase high-performance liquid chromatography, reported as a percentage of total peak area. Because that figure alone says little about the nature of the impurities, the accompanying chromatogram is normally the more useful document for judging a batch.