Everything below concerns Fragment designation. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-10-02. Numbers and descriptions here follow the published literature rather than marketing material.
Physical descriptions in supplier documents and papers usually list the compound as a white to off-white powder. It dissolves readily in water and in common aqueous buffers, and solutions are often prepared fresh before an experiment. Molecular mass near 1419 daltons helps verify identity during mass spectrometry. The powder is somewhat hygroscopic, so moisture exposure can alter the measured mass of a sample. Purity is typically reported as a percentage from chromatographic analysis.
BPC-157 is a synthetic fifteen-amino-acid peptide whose sequence is GEPPPGKPADDAGLV. Its name derives from the phrase body protection compound, a term applied to a protein fraction originally detected in human gastric juice. The short peptide is not that full protein; it corresponds to a stable fragment of the larger molecule. Researchers frequently describe it as a pentadecapeptide because it contains exactly fifteen residues. Its neutral molecular mass is approximately 1419 daltons.
The sequence places several glycine and proline residues near the middle, which may influence how the chain folds in solution. The peptide is linear rather than cyclic, and it carries no disulfide bridges. Commercial material is commonly supplied as the acetate salt, although the free base and other counterion forms also appear. Because the term BPC-157 refers to a specific sequence, samples with slight sequence variants are chemically different substances. Published work generally treats the fifteen-residue sequence as the defining structure.
Interest in the peptide has grown through online communities that discuss self-administered use, which sits outside formal research settings. Regulatory status varies by country, and in many jurisdictions the compound is not approved as a therapeutic product. Questions about optimal routes of administration, long-term effects, and dose-response relationships remain open. Published pharmacokinetic data in humans are limited, and much of what circulates in popular discussion is extrapolated from animal work rather than measured directly in people.
BPC-157 is a synthetic peptide built from fifteen amino acids, referred to in the literature as a pentadecapeptide. Its sequence was derived from a larger protein found in human gastric juice, commonly called body protection compound. Researchers first described the fragment in the early 1990s and named it after the parent protein plus a numeric identifier. The peptide does not correspond to a single marketed medicine; it is primarily a laboratory research material. Suppliers distribute it as a lyophilized powder intended for experimental use.
Published work on BPC-157 spans several decades and covers a wide range of experimental models. Much of the early literature reports outcomes in animal studies involving induced injury to the gastrointestinal tract, tendons, and other tissues. The volume of preclinical reports is large, while controlled human trials remain scarce. This imbalance is a recurring point of discussion, because animal findings do not automatically translate into human effects. Reviews often note that study designs differ substantially across laboratories.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C62H98N16O22 | Approximate, for sequence GEPPPGKPADDAGLV |
| Molecular mass | ~1419 Da | Neutral form |
| Appearance | White to off-white powder | Lyophilized solid |
| Solubility | Soluble in water | Also soluble in aqueous buffers |
| Typical storage | -20 C | Dry powder, protected from moisture |
Handling practice centers on limiting moisture, heat, and mechanical stress. Powder is typically allowed to reach room temperature before opening so that condensation does not form on the contents, and solutions are prepared with sterile or low-particulate water. Peptides can adsorb to certain plastics and membrane filters, so container and filter material is sometimes specified to reduce losses at low concentrations. Working aliquots are usually frozen separately rather than sampled repeatedly from one stock. Recording lot number, preparation date, and storage conditions supports later comparison between experiments.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography, which separates the target peptide from truncated sequences and other synthesis by-products. Mass spectrometry, typically electrospray ionization coupled to liquid chromatography, confirms the expected mass and helps detect modifications. Amino acid analysis can verify composition when residue-level confirmation is needed. Because common impurities differ from the target by only one or two residues, chromatographic resolution often matters more than a single headline purity percentage. Impurity profiles are most informative when compared against a validated reference standard.
Lyophilized material is generally reported as stable for extended periods when kept cold, dry, and protected from light. In solution, the main degradation routes for a peptide of this type are hydrolysis of peptide bonds and aggregation. The sequence contains no cysteine, so disulfide-driven oxidation is not a primary concern, though methionine and tryptophan are also absent. Stability depends on pH, buffer composition, and concentration, with acidic conditions often reported as more favorable than neutral or alkaline ones. Repeated freeze-thaw cycles can promote aggregation, and how fast degradation proceeds at room temperature in specific formulations remains an open question.
Confirmation of identity and purity relies on standard peptide analysis techniques. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities and serves as the most common purity assay. Mass spectrometry, often coupled to that chromatography step, provides an accurate molecular mass that can be matched against the expected value. Amino acid analysis or sequencing can be added for further confirmation. Because short peptides can be produced by different synthetic routes, laboratories usually report both a chromatographic purity percentage and a mass confirmation rather than a single figure.
BPC-157 is commonly supplied as a lyophilized powder, a freeze-dried solid that is reconstituted before use in laboratory work. As a short peptide, it dissolves readily in water and in aqueous buffer solutions, and stock solutions are typically prepared in water or a mild buffer. The chain contains several proline and acidic residues, which influence how it behaves in solution. Because the solid can take up moisture, weighing and handling are usually performed under low-humidity conditions. Its solubility class is described as freely soluble in water rather than requiring an organic solvent.
Dry powder is generally stored at low temperature, with minus twenty degrees Celsius or colder advised for extended retention. Reconstituted solutions are less stable than the solid form and are normally kept cold and shielded from repeated freeze-thaw cycles. Light exposure is avoided because some peptides degrade under ultraviolet radiation. The exact rate of degradation depends on concentration, pH, and the presence of salts, so a single shelf life does not apply to every preparation. Reported stability figures should be read as indicative of typical handling rather than as universal constants.
Purity is ordinarily reported as a percentage from reverse-phase high-performance liquid chromatography, where the area of the main peak is compared with the total peak area. Identity is confirmed by mass spectrometry, since the measured mass can be checked against the value calculated from the sequence. Some certificates also include amino acid analysis or sequence confirmation by tandem mass spectrometry. A single purity number does not describe the profile of related impurities, so the underlying chromatogram and spectrum usually carry more information than the headline figure.
Material of this kind is sold for laboratory research, and labels typically state that it is not intended for human or veterinary use. In many countries it is not an approved medicine, and sports antidoping rules place it among prohibited non-approved substances. Buyers commonly review a certificate of analysis, an independent test report, and the declared storage conditions. Batch-to-batch variation in purity and in counterion content is possible, and how much that variation affects experimental outcomes remains an open question.
Lyophilized peptide is normally kept at minus twenty degrees Celsius or colder, away from light and moisture. Powder held under those conditions is widely treated as stable for long periods, although published stability studies for this exact sequence are sparse and often come from suppliers rather than independent laboratories. Once dissolved, solutions are generally handled cold and used within a short window, because peptide bonds can hydrolyze over time. Repeated freeze-thaw cycles are usually avoided to limit losses, and exact shelf-life figures depend on the buffer and the concentration involved.
BPC-157 is a synthetic peptide of fifteen amino acids, written in single-letter code as GEPPPGKPADDAGLV. The sequence corresponds to a partial fragment of a protein isolated from human gastric juice, described in early reports as body protection compound. The number 157 refers to a fragment designation in that work rather than to molecular mass. Initial descriptions appeared in the early 1990s, when the fragment was reported to protect gastrointestinal tissue in animal models. Commercial material is produced by solid-phase peptide synthesis rather than extracted from biological sources.
Laboratory research on this peptide has examined a wide and heterogeneous set of endpoints, including gastric ulcer models, tendon and ligament injury, wound closure, and intestinal inflammation. Most published findings come from rodent studies, and reported effect sizes are often large relative to controls. Because the compound has been tested across many unrelated injury models, the literature is frequently described as unusually broad for a single peptide. A substantial share of this work originates from a small number of research groups, which matters when assessing how widely results have been reproduced.
The king cobra (Ophiophagus hannah) is a species complex of snakes endemic to Asia. With an average length of 3.18 to 4 m (10.4 to 13.1 ft) and a record length of 5.85 m (19.2 ft), it is the world's longest venomous snake and among the heaviest. Under the genus Ophiophagus, it is not phylogenetically a true cobra despite its common name and some resemblance. Spanning from the Indian subcontinent through Southeastern Asia to Southern China, the king cobra is widely distributed albeit not commonly seen. Individuals have diversified colouration across its habitats, from black with white strips to unbroken brownish grey, although after taxonomic re-evaluation, it is no longer the sole member of its genus but is now a species complex; these differences in pattern and other aspects may cause the genus to be split into at least four species, spread across its large geographic range. It chiefly hunts other snakes, including those of its own kind, although other lizards and rodents are also occasional prey. This is the only ophidian that constructs an above-ground nest for its eggs, which are purposefully and meticulously gathered and protected by the female throughout the incubation period. Typical threat display of this elapid includes neck-flap spreading, head raising, hissing and sometimes charging. Capable of striking at a considerable range and height with an immense venom yield, envenomation from this species may induce rapid onset of neurotoxic and cytotoxic symptoms, requiring prompt antivenom administration.
==== Pancreatic extracts before insulin ==== The limit to early diabetes control was partly due to the common-sense assumption that the stomach was wholly responsible for nutrient metabolism. As physiologists came to better understand the metabolic role of other organs, they began to hypothesize alternative causes for the disease. Through accumulating evidence, it was established that the "cause" of diabetes could be localized to the pancreas, then to its internal secretion (see: History of diabetes#Pathophysiology#Role of the pancreas). These findings fueled attempts to treat diabetes in animals and humans with direct extracts from the pancreas, by no less than 400 researchers according to historian Michael Bliss. In the early 1900s, Georg Ludwig Zuelzer experimented extensively with pancreatic extracts. After initial tests on rabbits, he injected his extracts (which he called acomatol) on humans to clear but inconsistent success and severe side-effects. He nonetheless took out an American patent on his yet-problematic extracts. Unfortunately, Zuelzer was ultimately unable to purify the extract due to difficulty obtaining pancreases, a lack of funding, and interruption by World War I. Ernest Lyman Scott, studying at the University of Chicago between 1911 and 1912, also obtained some promising results but was discouraged from continuing. In 1913, John MacLeod, at the time several years into research in the area of carbohydrate metabolism and blood sugar behaviour, synthesized the state of research in Diabetes: Its Pathological Physiology.
Most people are treated with levothyroxine, or a similar synthetic thyroid hormone. Different polymorphs of the compound have different solubilities and potencies. Additionally, natural thyroid hormone supplements from the dried thyroids of animals are available. Levothyroxine contains T4 only and is therefore largely ineffective for patients unable to convert T4 to T3. These patients may choose to take natural thyroid hormone, as it contains a mixture of T4 and T3, or alternatively supplement with a synthetic T3 treatment. In these cases, synthetic liothyronine is preferred due to the potential differences between the natural thyroid products. Some studies show that mixed therapy is beneficial to all patients, but the addition of lyothyronine causes side effects, so the medication should be evaluated on an individual basis. These desiccated thyroid extract formulations predate the modern FDA drug approval process and have not undergone formal FDA review for safety and efficacy under current approval standards. Thyroid hormones are generally well tolerated. Thyroid hormones are usually not dangerous for pregnant women or nursing mothers, but should be given under a physician's supervision. In fact, if a pregnant woman with hypothyroidism is left untreated, her fetus is at a higher risk for congenital disabilities relative to the norm. When pregnant, a woman with a low-functioning thyroid will also need to increase her dosage of thyroid hormone.
== Awards == In 1980, she was the recipient of a Guggenheim Fellowship. Other honors include the Award for Distinguished Contributions to Psychology in the Public Interest of the American Psychological Association, the NYU Alumni Achievement Award, the Liberty Science Center Genius Award, the Distinguished Contributions of Basic Science to Applied Psychology award from the American Association of Applied and Preventive Psychology, the James McKeen Cattel Award, and the Gordon Allport Intergroup Relations Prize.
=== Modifications in nature === Ribokinase catalyzes the conversion of d-ribose to d-ribose 5-phosphate. Once converted, d-ribose-5-phosphate is available for the manufacturing of the amino acids tryptophan and histidine, or for use in the pentose phosphate pathway. The absorption of d-ribose is 88–100% in the small intestines (up to 200 mg/kg·h). One important modification occurs at the C2' position of the ribose molecule. By adding an O-alkyl group, the nuclear resistance of the RNA is increased because of additional stabilizing forces. These forces are stabilizing because of the increase of intramolecular hydrogen bonding and an increase in the glycosidic bond stability. The resulting increase of resistance leads to increases in the half-life of siRNA and the potential therapeutic potential in cells and animals. The methylation of ribose at particular sites is correlated with a decrease in immune stimulation.
Sources: en.wikipedia.org
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
A direct relativistic effect is that as the atomic numbers of elements increase, the innermost electrons begin to revolve faster around the nucleus as a result of an increase of electromagnetic attraction between an electron and a nucleus. Similar effects have been found for the outermost s orbitals (and p1/2 ones, though in dubnium they are not occupied): for example, the 7s orbital contracts by 25% in size and is stabilized by 2.6 eV. A more indirect effect is that the contracted s and p1/2 orbitals shield the charge of the nucleus more effectively, leaving less for the outer d and f electrons, which therefore move in larger orbitals. Dubnium is greatly affected by this: unlike the previous group 5 members, its 7s electrons are slightly more difficult to extract than its 6d electrons.
Most of the explosions targeted antennas and active military bases. Early reports suggested that the explosions were at Generalissimo Francisco de Miranda Air Base (La Carlota) and Fort Tiuna, two military installations in Caracas. Large explosions were also reported at Higuerote Airport, on the Venezuelan coast. Helicopters from the 160th Special Operations Aviation Regiment carried Delta Force soldiers into Caracas with air cover provided by the fighters and bombers. One helicopter was damaged by Venezuelan ground defenses but continued on its mission. Federal Bureau of Investigation (FBI) personnel, including the Hostage Rescue Team, accompanied the military to formally arrest Maduro at his compound. The strikes lasted half an hour. Smoke was seen rising from one military hangar in a Caracas base, while another was left unpowered. The strikes happened under the cover of darkness as a result of both the timing of the operation and the US military's disruption of power in the city of Caracas. Multiple shipping containers were destroyed and damaged in the La Guaira port strikes. Satellite imagery from Vantor showed at least five destroyed warehouses, burned vehicles, and a blown-up security post. An aircraft, believed to be a Beechcraft Baron, and a Buk-M2E surface-to-air missile system were destroyed at Higuerote Airport.
==== Tissue engineering ==== Cells are very sensitive to nanotopographical features, so optimization of surfaces in tissue engineering has pushed towards implantation. Under appropriate conditions, a carefully crafted 3-dimensional scaffold is used to direct cell seeds toward artificial organ growth. The 3-D scaffold incorporates various nanoscale factors that control the environment for optimal and appropriate functionality. The scaffold is an analog of the in vivo extracellular matrix in vitro, allowing for successful artificial organ growth by providing the necessary, complex biological factors in vitro.
==== Metabolism ==== Pregabalin undergoes little or no metabolism. In experiments using nuclear medicine techniques, it was revealed that approximately 98% of the radioactivity recovered in the urine was unchanged pregabalin. The main metabolite is N-methylpregabalin. Pregabalin is generally safe in patients with liver cirrhosis.
Sources: en.wikipedia.org
== January 27, 1982 (Wednesday) == A train crash killed 131 people in Algeria at the town of Bouhalouane in Chlef Province. After the locomotive and eight passenger cars stalled while climbing a steep grade in the Atlas Mountains. The locomotive was uncoupled from the rest of the train, and the unsecured train cars rolled back down the slope and collided with a freight train at the station. On the same day in India, a train crash killed at least 63 people at Agra in Uttar Pradesh when a passenger express train was struck by a freight train that had pulled into its path. The government of Garret FitzGerald in Ireland was defeated, 82 to 81, on its budget and the 22nd Dáil was dissolved, with new elections for the 166 seats of the Dáil Éireann to take place on February 18. Seven members of the Colombian terrorist group M-19 hijacked an Aerotal Airways Boeing 727 flight with 121 other people aboard, shortly after it took off from Bogotá on a flight toward Pereira, Colombia. The M-19 group diverted the plane to Cali, where 47 women, children and elderly passengers were released, and threatened to blow the plane up if their demands were not met. The next day, a private jet was provided to the hijackers in return for the release of the remaining hostages and allowed to fly to Havana in Cuba, following a mediation by the Catholic Church. After landing Havana, the hijackers surrendered to police.
Bažant (1983) proposed a crack band model for materials like concrete whose homogeneous nature changes randomly over a certain range. He also observed that in plain concrete, the size effect has a strong influence on the critical stress intensity factor, and proposed the relation
=== J: Diseases of the respiratory system === (J86.0) Pyothorax with fistula (J95.0) Tracheoesophageal fistula, between the trachea and the esophagus. This may be congenital or acquired, for example as a complication of a tracheostomy.
=== Engine coolant standards === The Volkswagen Group has been particularly committed to the development of coolants and their standards (VW TL 774) in collaboration with Haertol Chemie from Magdeburg. VW standards include: G11, G12, G12+, G12++, G13 and G12evo. Another company involved in the development is BASF (Glysantin), whose standards are: G30, G40, G48, G05, G33, and G34. Volkswagen Group:
Also in the year 1808, at the conclusion of the Spanish reconquest of Santo Domingo and the repossession of the Eastern half of Hispaniola by Spain, the Governor General of Cuba sent all of the recent arrived refugees back to that colony. In so doing, these immigrants then dismantled their two Lodges they had been operating, Concordia and Perseverancia, and left the island. Many of these refugees moved to New Orleans, Louisiana District by 1809, and the next year, established the Concorde Lodge, No. 117, chartered under the Grand Lodge of Pennsylvania. Later in 1810, with three other Lodges in New Orleans, they established the Grand Lodge of Louisiana. Perseverancia was also reorganized in New Orleans under the name Perseverance Lodge No. 118. The only one of these Lodges that remained in Cuba was the Temple of the Theologic Virtues, and it also changed its name to Spanish; Templo de las Virtudes Teologales. The French members mostly having left the island, the remaining members were mostly Creole.
Sources: en.wikipedia.org
The letters BPC stand for body protection compound. The number 157 refers to a specific fragment designation from early work on gastric proteins. The full name is a label for a synthetic fifteen-amino-acid peptide rather than a naturally isolated drug.
No. The gastric protein is larger, while BPC-157 is a short fragment sequence. The peptide is produced synthetically for research use. The relationship is one of sequence origin, not chemical identity.
It is most often supplied as a lyophilized powder, frequently as the acetate salt. The powder is reconstituted with water or a buffer before use. Free-base and other salt forms also exist but are less common in catalogs.
It is a synthetic peptide of fifteen amino acids whose sequence matches a fragment of a protein found in human gastric juice. It is studied mainly in laboratory and animal research rather than as an approved medicine.