nitric oxide system is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-03-10. Where a claim depends on a specific study, the study is described rather than over-claimed.
Interest in the peptide has grown through online communities that discuss self-administered use, which sits outside formal research settings. Regulatory status varies by country, and in many jurisdictions the compound is not approved as a therapeutic product. Questions about optimal routes of administration, long-term effects, and dose-response relationships remain open. Published pharmacokinetic data in humans are limited, and much of what circulates in popular discussion is extrapolated from animal work rather than measured directly in people.
BPC-157 is a synthetic peptide built from fifteen amino acids, referred to in the literature as a pentadecapeptide. Its sequence was derived from a larger protein found in human gastric juice, commonly called body protection compound. Researchers first described the fragment in the early 1990s and named it after the parent protein plus a numeric identifier. The peptide does not correspond to a single marketed medicine; it is primarily a laboratory research material. Suppliers distribute it as a lyophilized powder intended for experimental use.
Published work on BPC-157 spans several decades and covers a wide range of experimental models. Much of the early literature reports outcomes in animal studies involving induced injury to the gastrointestinal tract, tendons, and other tissues. The volume of preclinical reports is large, while controlled human trials remain scarce. This imbalance is a recurring point of discussion, because animal findings do not automatically translate into human effects. Reviews often note that study designs differ substantially across laboratories.
The molecule carries 15 residues, a molar mass near 1419.5 g/mol, and the formula C62H98N16O22. Its structure features a proline-rich central region, a pair of adjacent aspartic acid residues, and no cysteine. The absence of cysteine means no disulfide bonds can form, which simplifies refolding and reconstitution. Suppliers usually ship the material as a freeze-dried powder that appears white to off-white. It dissolves readily in water and in saline solutions.
Published storage guidance follows general peptide practice rather than product-specific studies. The dry powder is typically kept at minus 20 degrees Celsius, away from light and moisture. Once reconstituted, solutions are generally refrigerated and used over days to weeks, because the aqueous environment slowly promotes hydrolysis and oxidation. Long-term data on degradation rates or breakdown products are sparse. Stated shelf lives from different producers vary widely, reflecting the absence of a shared reference standard.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic pentadecapeptide | Fifteen amino acids; sequence matches a fragment of a gastric juice protein |
| Molecular formula | C62H98N16O22 | Corresponds to a molecular mass near 1419 Da |
| Primary origin | Fragment of human gastric juice protein BPC | First characterized in the early 1990s |
| Common synonyms | BPC 157; PL 14736; pentadecapeptide BPC 157 | Naming conventions vary across publications |
| Reported stability | Stable in gastric juice during in vitro incubation | Based on laboratory incubation, not clinical data |
Peptides are susceptible to hydrolysis, oxidation, and aggregation, and BPC-157 is no exception. The lyophilized powder form is generally more stable than a solution because residual moisture is low and molecular mobility is reduced. Once dissolved, the peptide is exposed to water, oxygen, and trace metal ions that accelerate degradation. Light exposure and repeated freeze-thaw cycles are also commonly cited as sources of loss. These general principles guide most handling recommendations found in supplier documentation.
Standard practice for the solid form is storage at minus twenty degrees Celsius or colder, kept dry and away from light. Containers are usually sealed with a desiccant to limit moisture uptake. Reconstituted solutions are typically held at two to eight degrees Celsius and used within a short window, because potency can decline over days to weeks depending on the buffer and concentration. Freezing an already dissolved sample may help, though repeated thawing is discouraged. Specific shelf-life claims vary between suppliers and are rarely supported by published stability studies.
Proposed mechanisms in the literature involve the nitric oxide system, vascular endothelial growth factor signaling, and epidermal growth factor receptor pathways. Some studies report changes in blood vessel formation or in inflammatory mediators, while others describe interactions with nervous tissue. Much of this evidence rests on molecular markers in cultured cells or animal models. Whether the same pathways operate the same way in humans has not been established. Authors therefore tend to describe mechanisms as hypothetical rather than settled.
Direct human evidence is scarce. One trial in ulcerative colitis delivered the compound by enema and produced limited publicly reported results without a clear benefit. The compound is not an approved medicine in most jurisdictions. In many markets it is sold as a research chemical; in others it falls under prescription or controlled categories. Regulators have not confirmed any claimed medical use, and product labels rarely undergo premarket review.
Most published reports describe experiments in rodents rather than in people. These studies examine outcomes in tendons, ligaments, bone, stomach lining, and intestinal tissue. In rat and mouse models, a frequently reported effect is faster healing or reduced damage. Sample sizes are usually small, and a substantial share of the work originates from a small number of research groups. Independent replication is limited, so how far the findings extend to humans remains an open question.
Albumin is a family of globular proteins, the most common of which are the serum albumins. All of the proteins of the albumin family are water-soluble, moderately soluble in concentrated salt solutions, and experience heat denaturation. Albumins are commonly found in blood plasma and differ from other blood proteins in that they are not glycosylated. Substances containing albumins are called albuminoids. A number of blood transport proteins are evolutionarily related in the albumin family, including serum albumin, alpha-fetoprotein, vitamin D-binding protein and afamin. This family is only found in vertebrates. Albumins in a less strict sense can mean other proteins that coagulate under certain conditions. See Other albumin types for lactalbumin, ovalbumin and plant "2S albumin". Albumins in general are transport proteins that bind to various ligands and carry them around. Human types include:
Vasoactive intestinal peptide (VIP) is a 28-residue amino acid peptide first characterized in 1970 that was initially isolated from porcine duodenum. A member of the secretin/glucagon hormone superfamily, VIP was initially discovered owing to its potent vasodilatory effects (as its name implies). VIP is widely distributed in the central and peripheral nervous system as well as in the digestive, respiratory, reproductive, and cardiovascular systems as a neurotransmitter and neuroendocrine releasing factor. These effects contribute to an extensive range of physiological and pathological processes related to development, growth, and the control of neuronal, epithelial, and endocrine cell function. VIP acts on two receptors - VPAC1 and VPAC2, which are class B of G-protein-coupled receptors (GPCRs).VPAC1 is mainly present in the lung and T-lymphocytes, whereas VPAC2 is mainly seen in the smooth muscle, mast cells and the basal parts of the lung mucosa.
In molecular biology, Enhancer of rudimentary homolog is a protein that in humans is encoded by the ERH gene. The Drosophila protein enhancer of rudimentary protein is a small protein of 104 amino acids. It has been found to be an enhancer of the rudimentary gene, involved in pyrimidine biosynthesis. From an evolutionary point of view, enhancer of rudimentary is highly conserved and has been found to exist in probably all multicellular eukaryotic organisms. It has been proposed that this protein plays a role in the cell cycle. PDBe-KB provides an overview of all the structure information available in the PDB for Human Enhancer of rudimentary homolog (ERH) PDBe-KB provides an overview of all the structure information available in the PDB for Mouse Enhancer of rudimentary homolog (ERH)
People with Aarskog–Scott syndrome often have distinctive facial features, such as widely spaced eyes (hypertelorism), a small nose, a long area between the nose and mouth (philtrum), and a widow's peak hairline. They frequently have mild to moderate short stature during childhood, but their growth usually catches up with that of their peers during puberty. Hand abnormalities are common in this syndrome and include short fingers (brachydactyly), curved pinky fingers (fifth finger clinodactyly), webbing of the skin between some fingers (cutaneous syndactyly), and a single crease across the palm. Other abnormalities in people with Aarskog–Scott syndrome include heart defects and a split in the upper lip (cleft lip) with or without an opening in the roof of the mouth (cleft palate). Most males with Aarskog–Scott syndrome have a shawl scrotum, in which the scrotum surrounds the penis instead of hanging below. Less often, they have undescended testes (cryptorchidism) or a soft out-pouching around the belly-button (umbilical hernia) or in the lower abdomen (inguinal hernia). The intellectual development of people with Aarskog–Scott syndrome varies widely. Some may have mild learning and behavior problems, while others have normal intelligence. In rare cases, severe intellectual disability has been reported.
Sources: en.wikipedia.org
Leucine-rich repeat protein SHOC-2 is a protein that in humans is encoded by the SHOC2 gene. This protein was initially identified in Caenorhabditis elegans as SUR-8/SOC2 and was found to be a critical positive regulator of the ERK1/2 signaling pathway that integrates the Ras and RAF components of the ERK1/2 pathway into a multiprotein complex. Specifically, SHOC2 tethers RAS and PP1C proteins and in close proximity to RAF to dephosphorylate “S259” to enable MAPK signaling. The best-studied role of SHOC2 is in modulating signals of the extracellular signal-regulated kinase 1 and 2 (ERK1/2) pathway by forming a holophosphatase complex that activates RAF proteins.
Dexatrim has been on the market for more than 45 years. The brand was originally owned by Thompson Medical, which was acquired by Chattem in 1998. It is now part of Sanofi. Dexatrim formula has changed considerably over the years. In prior formulations, Dexatrim contained the decongestant phenylpropanolamine (PPA) and the amphetamine-like compound ephedra. A 2000 study by Yale University School of Medicine showed an increased risk of hemorrhagic stroke with taking PPA. A case of myocardial injury was also reported using Dexatrim (with PPA) at doses recommended for weight control. In 2000, following the request of the FDA to discontinue marketing drug products containing PPA, Dexatrim dropped PPA from its formula. In 2004, FDA banned a second Dexatrim ingredient, ephedra. Although ephedra showed some effectiveness for short-term weight loss, it was linked to raising blood pressure and increasing the risk of heart problems and stroke. In March 2014, Chattem sold Dexatrim to NVE Pharmaceuticals.
miR-324-5p is a microRNA that functions in cell growth, apoptosis, cancer, epilepsy, neuronal differentiation, psychiatric conditions, cardiac disease pathology, and more. As a microRNA, it regulates gene expression through targeting mRNAs. Additionally, miR-324-5p is both an intracellular miRNA, meaning it is commonly found within the microenvironment of the cell, and one of several circulating miRNAs found throughout the body. Its presence throughout the body both within and external to cells may contribute to miR-324-5p's wide array of functions and role in numerous disease pathologies – especially cancer – in various organ systems.
Sources: en.wikipedia.org
An ion-exchange membrane is generally made of organic or inorganic polymer with charged (ionic) side groups, such as ion-exchange resins. Anion-exchange membranes contain fixed cationic groups with predominantly mobile anions; because anions are the majority species, most of the conductivity is due to anion transport. The reverse holds for cation-exchange membranes. The so-called heterogeneous ion-exchange membranes have low cost and a thicker composition with higher resistance and a rough surface that can be subject to fouling. Homogeneous membranes are more expensive, but have a thinner composition with lower resistance and a smooth surface, less susceptible to fouling. Homogeneous membrane surfaces can be modified to alter the membrane permselectivity to protons, monovalent ions, and divalent ions. The selectivity of an ion-exchange membrane is due to Gibbs-Donnan equilibrium and not due to physically blocking or electrostatically excluding specific charged species. The selectivity to the transport of ions of opposite charges is called its permselectivity.
Calmodulin-like protein 5 is a protein that in humans is encoded by the CALML5 gene. This gene encodes a novel calcium binding protein expressed in the epidermis and related to the calmodulin family of calcium binding proteins. Functional studies with recombinant protein demonstrate it does bind calcium and undergoes a conformational change when it does so. Abundant expression is detected only in reconstructed epidermis and is restricted to differentiating keratinocytes. In addition, it can associate with transglutaminase 3, shown to be a key enzyme in the terminal differentiation of keratinocytes. Human CALML5 genome location and CALML5 gene details page in the UCSC Genome Browser. Overview of all the structural information available in the PDB for UniProt: Q9NZT1 (Human Calmodulin-like protein 5) at the PDBe-KB.
AlphaKnot is a scientific database and web server for detecting, classifying, and visualizing protein knots and other forms of protein-chain entanglement. It was developed to facilitate the analysis of protein structures predicted by AlphaFold and other machine-learning methods, but can also be used to analyze experimentally determined structures. The current version, AlphaKnot 2.0, combines two closely related components: a precomputed database containing proteins identified as knotted in large-scale structure-prediction datasets, and an analysis server that allows users to investigate the topology of individual protein structures in greater detail.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
It is a synthetic peptide of fifteen amino acids whose sequence matches a fragment of a protein found in human gastric juice. It is studied mainly in laboratory and animal research rather than as an approved medicine.
The letters abbreviate body protection compound, the name given to the parent protein isolated from gastric juice. The number is an identifier attached to the specific fragment, not a dose or a description of a chemical property.
The sequence corresponds to a segment of an endogenous gastric protein, but the isolated fifteen-amino-acid peptide is a synthetic construct. Whether the free fragment circulates in humans at measurable levels is not clearly established in the published literature.
It does not occur in the form that is supplied commercially. Its sequence matches a fragment of a larger gastric protein, and the research material is produced synthetically in a laboratory. The fragment described in the early literature is generally the same synthetic pentadecapeptide.